BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001848-TA|BGIBMGA001848-PA|undefined (340 letters) Database: mosquito 2123 sequences; 516,269 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090821-2|BAC57918.1| 1168|Anopheles gambiae reverse transcript... 24 7.0 AB090816-2|BAC57908.1| 1201|Anopheles gambiae reverse transcript... 23 9.3 >AB090821-2|BAC57918.1| 1168|Anopheles gambiae reverse transcriptase protein. Length = 1168 Score = 23.8 bits (49), Expect = 7.0 Identities = 13/60 (21%), Positives = 26/60 (43%) Query: 153 FSTGVWMAVAIASIASTVTLYITSLWEIRIEKNPTQLDGSIGDALLLTMSAVTQQAVIEP 212 F+T W ++A A A V + + + + + D + G + VTQ +++ P Sbjct: 584 FNTASWQSIAEALQAKGVPVQLCRILQDYFADRELEYDTADGPVTRRVSAGVTQGSILGP 643 >AB090816-2|BAC57908.1| 1201|Anopheles gambiae reverse transcriptase protein. Length = 1201 Score = 23.4 bits (48), Expect = 9.3 Identities = 15/60 (25%), Positives = 24/60 (40%) Query: 153 FSTGVWMAVAIASIASTVTLYITSLWEIRIEKNPTQLDGSIGDALLLTMSAVTQQAVIEP 212 F+T W A+A A + V Y+ + E D S G + V Q +++ P Sbjct: 650 FNTANWQAIADALQSKNVPSYLMKIIGAYFEGRKLLFDTSEGPVERHISAGVPQGSILGP 709 Database: mosquito Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 516,269 Number of sequences in database: 2123 Lambda K H 0.324 0.137 0.412 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 320,326 Number of Sequences: 2123 Number of extensions: 12976 Number of successful extensions: 75 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 73 Number of HSP's gapped (non-prelim): 2 length of query: 340 length of database: 516,269 effective HSP length: 64 effective length of query: 276 effective length of database: 380,397 effective search space: 104989572 effective search space used: 104989572 T: 11 A: 40 X1: 15 ( 7.0 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.6 bits) S2: 48 (23.4 bits)
- SilkBase 1999-2023 -