BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001844-TA|BGIBMGA001844-PA|undefined (54 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_02_0324 - 7463482-7463601,7463660-7463736,7463827-7463883,746... 26 3.2 01_07_0344 - 42869465-42869502,42869597-42869771,42869923-428701... 26 3.2 01_06_0241 - 27813076-27813622,27813695-27814125 25 9.8 >03_02_0324 - 7463482-7463601,7463660-7463736,7463827-7463883, 7464154-7464246,7464528-7464654,7464836-7466794 Length = 810 Score = 26.2 bits (55), Expect = 3.2 Identities = 11/35 (31%), Positives = 19/35 (54%) Query: 7 LLLRQCNITEALDVNKKRYSGNRRLGPDSGIWSDH 41 L L+ C T+ L + ++ +S RLG D ++ H Sbjct: 127 LALKSCAATDGLVLGRQIHSSTARLGLDGNVFVAH 161 >01_07_0344 - 42869465-42869502,42869597-42869771,42869923-42870117, 42870678-42870788,42870899-42871111,42871551-42871658, 42871732-42871873,42872150-42873449,42874032-42874085, 42874491-42874923 Length = 922 Score = 26.2 bits (55), Expect = 3.2 Identities = 12/31 (38%), Positives = 18/31 (58%) Query: 12 CNITEALDVNKKRYSGNRRLGPDSGIWSDHR 42 CN T+ L +K +Y +R G SG+ SD + Sbjct: 195 CNGTDLLSSSKVQYGLHRETGAISGLHSDSK 225 >01_06_0241 - 27813076-27813622,27813695-27814125 Length = 325 Score = 24.6 bits (51), Expect = 9.8 Identities = 9/33 (27%), Positives = 18/33 (54%) Query: 9 LRQCNITEALDVNKKRYSGNRRLGPDSGIWSDH 41 LR+ N+ + V K Y+ ++ GP + W ++ Sbjct: 143 LRKLNLVQCTPVEKTLYASHQLRGPAADWWENY 175 Database: rice Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.316 0.129 0.379 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,483,749 Number of Sequences: 37544 Number of extensions: 40361 Number of successful extensions: 79 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 76 Number of HSP's gapped (non-prelim): 3 length of query: 54 length of database: 14,793,348 effective HSP length: 35 effective length of query: 19 effective length of database: 13,479,308 effective search space: 256106852 effective search space used: 256106852 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits) S2: 51 (24.6 bits)
- SilkBase 1999-2023 -