BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001844-TA|BGIBMGA001844-PA|undefined (54 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_36694| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.9 SB_48647| Best HMM Match : Pencillinase_R (HMM E-Value=0.17) 25 8.6 >SB_36694| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1803 Score = 25.8 bits (54), Expect = 4.9 Identities = 17/39 (43%), Positives = 23/39 (58%), Gaps = 4/39 (10%) Query: 4 KTQLLLRQCNITEALDVN---KKRYSGNRRLGPDSGIWS 39 K+ L+ I EA+ VN KK+ SG+ RL DS +WS Sbjct: 1339 KSSTRLKSHGIDEAM-VNFPDKKKLSGHERLRYDSLVWS 1376 >SB_48647| Best HMM Match : Pencillinase_R (HMM E-Value=0.17) Length = 1084 Score = 25.0 bits (52), Expect = 8.6 Identities = 9/20 (45%), Positives = 12/20 (60%) Query: 23 KRYSGNRRLGPDSGIWSDHR 42 + Y NR PD G+W +HR Sbjct: 986 RSYVKNRIAKPDLGVWVNHR 1005 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.316 0.129 0.379 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,731,924 Number of Sequences: 59808 Number of extensions: 45074 Number of successful extensions: 87 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 85 Number of HSP's gapped (non-prelim): 3 length of query: 54 length of database: 16,821,457 effective HSP length: 34 effective length of query: 20 effective length of database: 14,787,985 effective search space: 295759700 effective search space used: 295759700 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits) S2: 52 (25.0 bits)
- SilkBase 1999-2023 -