BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001842-TA|BGIBMGA001842-PA|undefined (652 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. 27 0.48 >DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. Length = 828 Score = 27.1 bits (57), Expect = 0.48 Identities = 17/56 (30%), Positives = 32/56 (57%), Gaps = 6/56 (10%) Query: 275 LSKIIDHHSEM-NTINVNQDQFFSMIDLINTKKNGLSKEFSGDLIKQL-SKYKDIY 328 LSK+ID HS++ +T+ + +++D + + N L+ + + D K L KY + Y Sbjct: 358 LSKVIDQHSQLIDTL----ENVLAIVDRLMDETNQLTLQETADAFKDLQDKYYEEY 409 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.316 0.132 0.389 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 174,642 Number of Sequences: 429 Number of extensions: 7052 Number of successful extensions: 8 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 8 Number of HSP's gapped (non-prelim): 1 length of query: 652 length of database: 140,377 effective HSP length: 62 effective length of query: 590 effective length of database: 113,779 effective search space: 67129610 effective search space used: 67129610 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits) S2: 47 (23.0 bits)
- SilkBase 1999-2023 -