GeneModel BLAST Result against bee

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA001842-TA|BGIBMGA001842-PA|undefined
         (652 letters)

Database: bee 
           429 sequences; 140,377 total letters

Searching.....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ342041-1|ABC69933.1|  828|Apis mellifera STIP protein.               27   0.48 

>DQ342041-1|ABC69933.1|  828|Apis mellifera STIP protein.
          Length = 828

 Score = 27.1 bits (57), Expect = 0.48
 Identities = 17/56 (30%), Positives = 32/56 (57%), Gaps = 6/56 (10%)

Query: 275 LSKIIDHHSEM-NTINVNQDQFFSMIDLINTKKNGLSKEFSGDLIKQL-SKYKDIY 328
           LSK+ID HS++ +T+    +   +++D +  + N L+ + + D  K L  KY + Y
Sbjct: 358 LSKVIDQHSQLIDTL----ENVLAIVDRLMDETNQLTLQETADAFKDLQDKYYEEY 409


  Database: bee
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 140,377
  Number of sequences in database:  429
  
Lambda     K      H
   0.316    0.132    0.389 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 174,642
Number of Sequences: 429
Number of extensions: 7052
Number of successful extensions: 8
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 8
Number of HSP's gapped (non-prelim): 1
length of query: 652
length of database: 140,377
effective HSP length: 62
effective length of query: 590
effective length of database: 113,779
effective search space: 67129610
effective search space used: 67129610
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.6 bits)
S2: 47 (23.0 bits)