BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001840-TA|BGIBMGA001840-PA|IPR005055|Insect pheromone-binding protein A10/OS-D (65 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value DQ855484-1|ABH88171.1| 130|Apis mellifera chemosensory protein ... 65 6e-14 AF481963-1|AAN59784.1| 130|Apis mellifera antennal-specific pro... 65 6e-14 AJ973401-1|CAJ01448.1| 130|Apis mellifera hypothetical protein ... 64 2e-13 DQ855487-1|ABH88174.1| 125|Apis mellifera chemosensory protein ... 49 5e-09 AJ973402-1|CAJ01449.1| 125|Apis mellifera hypothetical protein ... 49 5e-09 DQ855485-1|ABH88172.1| 128|Apis mellifera chemosensory protein ... 46 4e-08 AJ973400-1|CAJ01447.1| 128|Apis mellifera hypothetical protein ... 46 4e-08 DQ855482-1|ABH88169.1| 116|Apis mellifera chemosensory protein ... 44 2e-07 AJ973399-1|CAJ01446.1| 116|Apis mellifera hypothetical protein ... 44 2e-07 DQ855483-1|ABH88170.1| 117|Apis mellifera chemosensory protein ... 31 0.001 AJ973398-1|CAJ01445.1| 117|Apis mellifera hypothetical protein ... 31 0.001 DQ855486-1|ABH88173.1| 104|Apis mellifera chemosensory protein ... 23 0.30 DQ435325-1|ABD92640.1| 160|Apis mellifera OBP7 protein. 19 4.9 AB238796-1|BAE93398.1| 128|Apis mellifera Queen brain-selective... 19 6.4 DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase ... 18 8.5 DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase ... 18 8.5 >DQ855484-1|ABH88171.1| 130|Apis mellifera chemosensory protein 3 protein. Length = 130 Score = 65.3 bits (152), Expect = 6e-14 Identities = 27/63 (42%), Positives = 42/63 (66%) Query: 1 MKTHITDALQTGCTKCTGAQRKGIRRVIKHLIDSEPGYWDRLVDMYDPKRVYTGKYEKEL 60 +K + DAL T C KCT QR+ I++VIK L++++P WD L + YDP + Y K+E+E Sbjct: 64 LKRVLPDALATDCKKCTDKQREVIKKVIKFLVENKPELWDSLANKYDPDKKYRVKFEEEA 123 Query: 61 RTI 63 + + Sbjct: 124 KKL 126 >AF481963-1|AAN59784.1| 130|Apis mellifera antennal-specific protein 3c precursor protein. Length = 130 Score = 65.3 bits (152), Expect = 6e-14 Identities = 27/63 (42%), Positives = 42/63 (66%) Query: 1 MKTHITDALQTGCTKCTGAQRKGIRRVIKHLIDSEPGYWDRLVDMYDPKRVYTGKYEKEL 60 +K + DAL T C KCT QR+ I++VIK L++++P WD L + YDP + Y K+E+E Sbjct: 64 LKRVLPDALATDCKKCTDKQREVIKKVIKFLVENKPELWDSLANKYDPDKKYRVKFEEEA 123 Query: 61 RTI 63 + + Sbjct: 124 KKL 126 >AJ973401-1|CAJ01448.1| 130|Apis mellifera hypothetical protein protein. Length = 130 Score = 63.7 bits (148), Expect = 2e-13 Identities = 26/63 (41%), Positives = 42/63 (66%) Query: 1 MKTHITDALQTGCTKCTGAQRKGIRRVIKHLIDSEPGYWDRLVDMYDPKRVYTGKYEKEL 60 +K + DAL T C KCT QR+ I++VIK L++++P WD L + YDP + + K+E+E Sbjct: 64 LKRVLPDALATDCKKCTDKQREVIKKVIKFLVENKPELWDSLANKYDPDKKFRVKFEEEA 123 Query: 61 RTI 63 + + Sbjct: 124 KKL 126 >DQ855487-1|ABH88174.1| 125|Apis mellifera chemosensory protein 6 protein. Length = 125 Score = 48.8 bits (111), Expect = 5e-09 Identities = 23/64 (35%), Positives = 32/64 (50%) Query: 1 MKTHITDALQTGCTKCTGAQRKGIRRVIKHLIDSEPGYWDRLVDMYDPKRVYTGKYEKEL 60 +K + DAL TGC KC Q+ +V+ +L P W+RL YD Y +YE L Sbjct: 60 LKKILPDALSTGCNKCNEKQKHTANKVVNYLKTKRPKDWERLSAKYDSTGEYKKRYEHGL 119 Query: 61 RTIK 64 + K Sbjct: 120 QFAK 123 >AJ973402-1|CAJ01449.1| 125|Apis mellifera hypothetical protein protein. Length = 125 Score = 48.8 bits (111), Expect = 5e-09 Identities = 23/64 (35%), Positives = 32/64 (50%) Query: 1 MKTHITDALQTGCTKCTGAQRKGIRRVIKHLIDSEPGYWDRLVDMYDPKRVYTGKYEKEL 60 +K + DAL TGC KC Q+ +V+ +L P W+RL YD Y +YE L Sbjct: 60 LKKILPDALSTGCNKCNEKQKHTANKVVNYLKTKRPKDWERLSAKYDSTGEYKKRYEHGL 119 Query: 61 RTIK 64 + K Sbjct: 120 QFAK 123 >DQ855485-1|ABH88172.1| 128|Apis mellifera chemosensory protein 4 protein. Length = 128 Score = 46.0 bits (104), Expect = 4e-08 Identities = 20/56 (35%), Positives = 32/56 (57%) Query: 1 MKTHITDALQTGCTKCTGAQRKGIRRVIKHLIDSEPGYWDRLVDMYDPKRVYTGKY 56 +K ++ DAL+ C+ C+ Q+K +V++ LID++P W L YDP Y Y Sbjct: 63 LKRNLPDALENECSPCSEKQKKIADKVVQFLIDNKPEIWVLLEAKYDPTGAYKQHY 118 >AJ973400-1|CAJ01447.1| 128|Apis mellifera hypothetical protein protein. Length = 128 Score = 46.0 bits (104), Expect = 4e-08 Identities = 20/56 (35%), Positives = 32/56 (57%) Query: 1 MKTHITDALQTGCTKCTGAQRKGIRRVIKHLIDSEPGYWDRLVDMYDPKRVYTGKY 56 +K ++ DAL+ C+ C+ Q+K +V++ LID++P W L YDP Y Y Sbjct: 63 LKRNLPDALENECSPCSEKQKKIADKVVQFLIDNKPEIWVLLEAKYDPTGAYKQHY 118 >DQ855482-1|ABH88169.1| 116|Apis mellifera chemosensory protein 1 protein. Length = 116 Score = 43.6 bits (98), Expect = 2e-07 Identities = 17/49 (34%), Positives = 30/49 (61%) Query: 2 KTHITDALQTGCTKCTGAQRKGIRRVIKHLIDSEPGYWDRLVDMYDPKR 50 K+HIT+A QT C KCT Q++ + ++ + +EP W+ V++ K+ Sbjct: 64 KSHITEAFQTQCKKCTEIQKQNLDKLAEWFTTNEPEKWNHFVEIMIKKK 112 >AJ973399-1|CAJ01446.1| 116|Apis mellifera hypothetical protein protein. Length = 116 Score = 43.6 bits (98), Expect = 2e-07 Identities = 17/49 (34%), Positives = 30/49 (61%) Query: 2 KTHITDALQTGCTKCTGAQRKGIRRVIKHLIDSEPGYWDRLVDMYDPKR 50 K+HIT+A QT C KCT Q++ + ++ + +EP W+ V++ K+ Sbjct: 64 KSHITEAFQTQCKKCTEIQKQNLDKLAEWFTTNEPEKWNHFVEIMIKKK 112 >DQ855483-1|ABH88170.1| 117|Apis mellifera chemosensory protein 2 protein. Length = 117 Score = 31.1 bits (67), Expect = 0.001 Identities = 10/38 (26%), Positives = 22/38 (57%) Query: 9 LQTGCTKCTGAQRKGIRRVIKHLIDSEPGYWDRLVDMY 46 L+ C +C+ + + I++V+ H+ + P W ++V Y Sbjct: 76 LRGACPQCSPEETRQIKKVLSHIQRTYPKEWSKIVQQY 113 >AJ973398-1|CAJ01445.1| 117|Apis mellifera hypothetical protein protein. Length = 117 Score = 31.1 bits (67), Expect = 0.001 Identities = 10/38 (26%), Positives = 22/38 (57%) Query: 9 LQTGCTKCTGAQRKGIRRVIKHLIDSEPGYWDRLVDMY 46 L+ C +C+ + + I++V+ H+ + P W ++V Y Sbjct: 76 LRGACPQCSPEETRQIKKVLSHIQRTYPKEWSKIVQQY 113 >DQ855486-1|ABH88173.1| 104|Apis mellifera chemosensory protein 5 protein. Length = 104 Score = 23.0 bits (47), Expect = 0.30 Identities = 11/52 (21%), Positives = 21/52 (40%) Query: 1 MKTHITDALQTGCTKCTGAQRKGIRRVIKHLIDSEPGYWDRLVDMYDPKRVY 52 +K + + L C +CT Q +I + + P W ++ Y + Y Sbjct: 53 IKELLPEVLNNHCNRCTSRQIGIANTLIPFMQQNYPYEWQLILRRYKIMKYY 104 >DQ435325-1|ABD92640.1| 160|Apis mellifera OBP7 protein. Length = 160 Score = 19.0 bits (37), Expect = 4.9 Identities = 7/22 (31%), Positives = 14/22 (63%) Query: 30 HLIDSEPGYWDRLVDMYDPKRV 51 H+I ++ D+LV+M + K + Sbjct: 87 HIIQNDEIQLDKLVEMANRKNI 108 >AB238796-1|BAE93398.1| 128|Apis mellifera Queen brain-selective protein-1 protein. Length = 128 Score = 18.6 bits (36), Expect = 6.4 Identities = 5/12 (41%), Positives = 7/12 (58%) Query: 7 DALQTGCTKCTG 18 + +Q C KC G Sbjct: 81 EGMQCSCNKCIG 92 >DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase isoform B protein. Length = 931 Score = 18.2 bits (35), Expect = 8.5 Identities = 8/27 (29%), Positives = 13/27 (48%) Query: 16 CTGAQRKGIRRVIKHLIDSEPGYWDRL 42 C G K IK ++ S+ +W+ L Sbjct: 611 CDGWGGKAGPCAIKSVVPSDESHWNDL 637 >DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase isoform A protein. Length = 969 Score = 18.2 bits (35), Expect = 8.5 Identities = 8/27 (29%), Positives = 13/27 (48%) Query: 16 CTGAQRKGIRRVIKHLIDSEPGYWDRL 42 C G K IK ++ S+ +W+ L Sbjct: 649 CDGWGGKAGPCAIKSVVPSDESHWNDL 675 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.321 0.137 0.425 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,038 Number of Sequences: 429 Number of extensions: 518 Number of successful extensions: 16 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of query: 65 length of database: 140,377 effective HSP length: 44 effective length of query: 21 effective length of database: 121,501 effective search space: 2551521 effective search space used: 2551521 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 35 (19.1 bits) S2: 35 (18.2 bits)
- SilkBase 1999-2023 -