Silkworm BLAST Result against mosquito

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA001838-TA|BGIBMGA001838-PA|IPR006578|MADF
         (361 letters)

Database: mosquito 
           2123 sequences; 516,269 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY752894-1|AAV30068.1|  156|Anopheles gambiae peroxidase 2 protein.    24   5.7  

>AY752894-1|AAV30068.1|  156|Anopheles gambiae peroxidase 2 protein.
          Length = 156

 Score = 24.2 bits (50), Expect = 5.7
 Identities = 12/32 (37%), Positives = 16/32 (50%), Gaps = 1/32 (3%)

Query: 252 ILLYKDLPCLWDKECPAYK-IKMKRHDAITKM 282
           I+ Y+ LP   DKE P Y   K   H  ++ M
Sbjct: 91  IVAYEYLPAFLDKEIPPYDGYKADTHPGVSHM 122


  Database: mosquito
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 516,269
  Number of sequences in database:  2123
  
Lambda     K      H
   0.320    0.135    0.405 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 372,570
Number of Sequences: 2123
Number of extensions: 14139
Number of successful extensions: 32
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 32
Number of HSP's gapped (non-prelim): 1
length of query: 361
length of database: 516,269
effective HSP length: 65
effective length of query: 296
effective length of database: 378,274
effective search space: 111969104
effective search space used: 111969104
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.8 bits)
S2: 48 (23.4 bits)