BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001838-TA|BGIBMGA001838-PA|IPR006578|MADF (361 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value DQ325067-1|ABD14081.1| 152|Apis mellifera complementary sex det... 22 7.1 DQ325066-1|ABD14080.1| 152|Apis mellifera complementary sex det... 22 7.1 DQ325065-1|ABD14079.1| 152|Apis mellifera complementary sex det... 22 7.1 DQ325064-1|ABD14078.1| 152|Apis mellifera complementary sex det... 22 7.1 DQ325063-1|ABD14077.1| 152|Apis mellifera complementary sex det... 22 7.1 DQ325062-1|ABD14076.1| 152|Apis mellifera complementary sex det... 22 7.1 DQ325061-1|ABD14075.1| 152|Apis mellifera complementary sex det... 22 7.1 AY569719-1|AAS86672.1| 401|Apis mellifera complementary sex det... 22 7.1 AY569718-1|AAS86671.1| 401|Apis mellifera complementary sex det... 22 7.1 AY569715-1|AAS86668.1| 401|Apis mellifera complementary sex det... 22 7.1 AY569714-1|AAS86667.1| 401|Apis mellifera complementary sex det... 22 7.1 AY569713-1|AAS86666.1| 401|Apis mellifera complementary sex det... 22 7.1 AY569711-1|AAS86664.1| 401|Apis mellifera complementary sex det... 22 7.1 AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex det... 22 7.1 >DQ325067-1|ABD14081.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 22.2 bits (45), Expect = 7.1 Identities = 15/54 (27%), Positives = 24/54 (44%) Query: 269 YKIKMKRHDAITKMTELVQEYDPSATRVHILRKIESLRACVRREYKRVQESRRK 322 YK K +R+D + + E S R R+ E REY+ +E+ R+ Sbjct: 12 YKKKDRRYDQLHNVEEKHLRERTSRRRYSRSREREQKSYKNEREYREYRETSRE 65 >DQ325066-1|ABD14080.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 22.2 bits (45), Expect = 7.1 Identities = 15/54 (27%), Positives = 24/54 (44%) Query: 269 YKIKMKRHDAITKMTELVQEYDPSATRVHILRKIESLRACVRREYKRVQESRRK 322 YK K +R+D + + E S R R+ E REY+ +E+ R+ Sbjct: 12 YKKKDRRYDQLHNVEEKHLRERTSRRRYSRSREREQKSYKNEREYREYRETSRE 65 >DQ325065-1|ABD14079.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 22.2 bits (45), Expect = 7.1 Identities = 15/54 (27%), Positives = 24/54 (44%) Query: 269 YKIKMKRHDAITKMTELVQEYDPSATRVHILRKIESLRACVRREYKRVQESRRK 322 YK K +R+D + + E S R R+ E REY+ +E+ R+ Sbjct: 12 YKKKDRRYDQLHNVEEKHLRERTSRRRYSRSREREQKSYKNEREYREYRETSRE 65 >DQ325064-1|ABD14078.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 22.2 bits (45), Expect = 7.1 Identities = 15/54 (27%), Positives = 24/54 (44%) Query: 269 YKIKMKRHDAITKMTELVQEYDPSATRVHILRKIESLRACVRREYKRVQESRRK 322 YK K +R+D + + E S R R+ E REY+ +E+ R+ Sbjct: 12 YKKKDRRYDQLHNVEEKHLRERTSRRRYSRSREREQKSYKNEREYREYRETSRE 65 >DQ325063-1|ABD14077.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 22.2 bits (45), Expect = 7.1 Identities = 15/54 (27%), Positives = 24/54 (44%) Query: 269 YKIKMKRHDAITKMTELVQEYDPSATRVHILRKIESLRACVRREYKRVQESRRK 322 YK K +R+D + + E S R R+ E REY+ +E+ R+ Sbjct: 12 YKKKDRRYDQLHNVEEKHLRERTSRRRYSRSREREQKSYKNEREYREYRETSRE 65 >DQ325062-1|ABD14076.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 22.2 bits (45), Expect = 7.1 Identities = 15/54 (27%), Positives = 24/54 (44%) Query: 269 YKIKMKRHDAITKMTELVQEYDPSATRVHILRKIESLRACVRREYKRVQESRRK 322 YK K +R+D + + E S R R+ E REY+ +E+ R+ Sbjct: 12 YKKKDRRYDQLHNVEEKHLRERTSRRRYSRSREREQKSYKNEREYREYRETSRE 65 >DQ325061-1|ABD14075.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 22.2 bits (45), Expect = 7.1 Identities = 15/54 (27%), Positives = 24/54 (44%) Query: 269 YKIKMKRHDAITKMTELVQEYDPSATRVHILRKIESLRACVRREYKRVQESRRK 322 YK K +R+D + + E S R R+ E REY+ +E+ R+ Sbjct: 12 YKKKDRRYDQLHNVEEKHLRERTSRRRYSRSREREQKSYKNEREYREYRETSRE 65 >AY569719-1|AAS86672.1| 401|Apis mellifera complementary sex determiner protein. Length = 401 Score = 22.2 bits (45), Expect = 7.1 Identities = 15/54 (27%), Positives = 24/54 (44%) Query: 269 YKIKMKRHDAITKMTELVQEYDPSATRVHILRKIESLRACVRREYKRVQESRRK 322 YK K +R+D + + E S R R+ E REY+ +E+ R+ Sbjct: 261 YKKKDRRYDQLHNVEEKHLRERTSRRRYSRSREREQKSYKNEREYREYRETSRE 314 >AY569718-1|AAS86671.1| 401|Apis mellifera complementary sex determiner protein. Length = 401 Score = 22.2 bits (45), Expect = 7.1 Identities = 15/54 (27%), Positives = 24/54 (44%) Query: 269 YKIKMKRHDAITKMTELVQEYDPSATRVHILRKIESLRACVRREYKRVQESRRK 322 YK K +R+D + + E S R R+ E REY+ +E+ R+ Sbjct: 261 YKKKDRRYDQLHNVEEKHLRERTSRRRYSRSREREQKSYKNEREYREYRETSRE 314 >AY569715-1|AAS86668.1| 401|Apis mellifera complementary sex determiner protein. Length = 401 Score = 22.2 bits (45), Expect = 7.1 Identities = 15/54 (27%), Positives = 24/54 (44%) Query: 269 YKIKMKRHDAITKMTELVQEYDPSATRVHILRKIESLRACVRREYKRVQESRRK 322 YK K +R+D + + E S R R+ E REY+ +E+ R+ Sbjct: 261 YKKKDRRYDQLHNVEEKHLRERTSRRRYSRSREREQKSYKNEREYREYRETSRE 314 >AY569714-1|AAS86667.1| 401|Apis mellifera complementary sex determiner protein. Length = 401 Score = 22.2 bits (45), Expect = 7.1 Identities = 15/54 (27%), Positives = 24/54 (44%) Query: 269 YKIKMKRHDAITKMTELVQEYDPSATRVHILRKIESLRACVRREYKRVQESRRK 322 YK K +R+D + + E S R R+ E REY+ +E+ R+ Sbjct: 261 YKKKDRRYDQLHNVEEKHLRERTSRRRYSRSREREQKSYKNEREYREYRETSRE 314 >AY569713-1|AAS86666.1| 401|Apis mellifera complementary sex determiner protein. Length = 401 Score = 22.2 bits (45), Expect = 7.1 Identities = 15/54 (27%), Positives = 24/54 (44%) Query: 269 YKIKMKRHDAITKMTELVQEYDPSATRVHILRKIESLRACVRREYKRVQESRRK 322 YK K +R+D + + E S R R+ E REY+ +E+ R+ Sbjct: 261 YKKKDRRYDQLHNVEEKHLRERTSRRRYSRSREREQKSYKNEREYREYRETSRE 314 >AY569711-1|AAS86664.1| 401|Apis mellifera complementary sex determiner protein. Length = 401 Score = 22.2 bits (45), Expect = 7.1 Identities = 15/54 (27%), Positives = 24/54 (44%) Query: 269 YKIKMKRHDAITKMTELVQEYDPSATRVHILRKIESLRACVRREYKRVQESRRK 322 YK K +R+D + + E S R R+ E REY+ +E+ R+ Sbjct: 261 YKKKDRRYDQLHNVEEKHLRERTSRRRYSRSREREQKSYKNEREYREYRETSRE 314 >AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex determiner protein. Length = 401 Score = 22.2 bits (45), Expect = 7.1 Identities = 15/54 (27%), Positives = 24/54 (44%) Query: 269 YKIKMKRHDAITKMTELVQEYDPSATRVHILRKIESLRACVRREYKRVQESRRK 322 YK K +R+D + + E S R R+ E REY+ +E+ R+ Sbjct: 261 YKKKDRRYDQLHNVEEKHLRERTSRRRYSRSREREQKSYKNEREYREYRETSRE 314 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.320 0.135 0.405 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 109,023 Number of Sequences: 429 Number of extensions: 4593 Number of successful extensions: 17 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 3 Number of HSP's gapped (non-prelim): 14 length of query: 361 length of database: 140,377 effective HSP length: 59 effective length of query: 302 effective length of database: 115,066 effective search space: 34749932 effective search space used: 34749932 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 44 (21.8 bits)
- SilkBase 1999-2023 -