BLASTP 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= BGIBMGA001837-TA|BGIBMGA001837-PA|undefined
(173 letters)
Database: mosquito
2123 sequences; 516,269 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
AM042695-1|CAJ14970.1| 396|Anopheles gambiae 3-hydroxykynurenin... 22 9.0
>AM042695-1|CAJ14970.1| 396|Anopheles gambiae 3-hydroxykynurenine
transaminase protein.
Length = 396
Score = 22.2 bits (45), Expect = 9.0
Identities = 11/34 (32%), Positives = 18/34 (52%)
Query: 22 DDEGRVGEMVTADLNEAATESLGGVAEPAIRNEI 55
D+ R V ++L A E+L +AE + N+I
Sbjct: 251 DEPKRYHHTVASNLIFALREALAQIAEEGLENQI 284
Database: mosquito
Posted date: Oct 5, 2007 11:13 AM
Number of letters in database: 516,269
Number of sequences in database: 2123
Lambda K H
0.314 0.129 0.371
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 149,440
Number of Sequences: 2123
Number of extensions: 4743
Number of successful extensions: 2
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 1
Number of HSP's gapped (non-prelim): 1
length of query: 173
length of database: 516,269
effective HSP length: 60
effective length of query: 113
effective length of database: 388,889
effective search space: 43944457
effective search space used: 43944457
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 42 (22.0 bits)
S2: 45 (22.2 bits)
- SilkBase 1999-2023 -