BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001835-TA|BGIBMGA001835-PA|IPR001159|Double-stranded RNA binding, IPR000999|Ribonuclease III (152 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AJ415419-1|CAC94468.1| 441|Tribolium castaneum transcription fa... 22 2.7 AY043293-2|AAK96034.1| 353|Tribolium castaneum homeodomain tran... 20 8.1 AY008296-1|AAG22858.1| 556|Tribolium castaneum Dorsal protein. 20 8.1 AF230313-1|AAF64147.1| 210|Tribolium castaneum labial protein p... 20 8.1 AF230312-1|AAF64146.1| 253|Tribolium castaneum labial protein p... 20 8.1 >AJ415419-1|CAC94468.1| 441|Tribolium castaneum transcription factor protein. Length = 441 Score = 21.8 bits (44), Expect = 2.7 Identities = 7/16 (43%), Positives = 10/16 (62%) Query: 137 SARPPPHTHSPYHDVQ 152 S PPPH ++P +Q Sbjct: 277 SLSPPPHVYNPPDHIQ 292 >AY043293-2|AAK96034.1| 353|Tribolium castaneum homeodomain transcription factor Labialprotein. Length = 353 Score = 20.2 bits (40), Expect = 8.1 Identities = 6/17 (35%), Positives = 11/17 (64%) Query: 3 GRQHYLIHEDEMEQAED 19 G QH+ +HE++ + D Sbjct: 125 GHQHHFLHENKYQLEVD 141 >AY008296-1|AAG22858.1| 556|Tribolium castaneum Dorsal protein. Length = 556 Score = 20.2 bits (40), Expect = 8.1 Identities = 11/47 (23%), Positives = 20/47 (42%) Query: 48 VWKSYGRLMGRELEAFSAAAPKSPVRELLEAEPDTAKFGKPERLADG 94 VW+ +G ++ +A K+P L+ F + R +DG Sbjct: 285 VWEGFGDFQPSQVHKQTAICFKAPRYHTLDITEPVKVFIQLRRPSDG 331 >AF230313-1|AAF64147.1| 210|Tribolium castaneum labial protein protein. Length = 210 Score = 20.2 bits (40), Expect = 8.1 Identities = 6/17 (35%), Positives = 11/17 (64%) Query: 3 GRQHYLIHEDEMEQAED 19 G QH+ +HE++ + D Sbjct: 125 GHQHHFLHENKYQLEVD 141 >AF230312-1|AAF64146.1| 253|Tribolium castaneum labial protein protein. Length = 253 Score = 20.2 bits (40), Expect = 8.1 Identities = 6/17 (35%), Positives = 11/17 (64%) Query: 3 GRQHYLIHEDEMEQAED 19 G QH+ +HE++ + D Sbjct: 125 GHQHHFLHENKYQLEVD 141 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.320 0.135 0.409 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 33,068 Number of Sequences: 317 Number of extensions: 1061 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of query: 152 length of database: 114,650 effective HSP length: 52 effective length of query: 100 effective length of database: 98,166 effective search space: 9816600 effective search space used: 9816600 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.3 bits) S2: 40 (20.2 bits)
- SilkBase 1999-2023 -