BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001830-TA|BGIBMGA001830-PA|IPR006055|Exonuclease, IPR013520|Exonuclease, RNase T and DNA polymerase III, IPR012337|Polynucleotidyl transferase, Ribonuclease H fold (183 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex det... 22 4.1 AB253415-1|BAE86926.1| 588|Apis mellifera alpha-glucosidase pro... 21 5.4 >AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex determiner protein. Length = 385 Score = 21.8 bits (44), Expect = 4.1 Identities = 9/30 (30%), Positives = 15/30 (50%) Query: 108 RDVSTYHLYTRYKKYNPTLRQLTRSYLSRG 137 R+ +Y Y+KY T ++ +R RG Sbjct: 278 REQKSYKNENSYRKYRETSKERSRDRRERG 307 >AB253415-1|BAE86926.1| 588|Apis mellifera alpha-glucosidase protein. Length = 588 Score = 21.4 bits (43), Expect = 5.4 Identities = 12/45 (26%), Positives = 20/45 (44%) Query: 73 VRQAVSRILKNCLLVGYDVSRSLRLLGLGHPEDNIRDVSTYHLYT 117 + S+I +N L + + GL ++ +S YHLYT Sbjct: 422 INAGFSKIAENLLEKNWLPVHTSYKSGLNLEQEKKDSISHYHLYT 466 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.318 0.134 0.385 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 51,204 Number of Sequences: 429 Number of extensions: 2101 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of query: 183 length of database: 140,377 effective HSP length: 54 effective length of query: 129 effective length of database: 117,211 effective search space: 15120219 effective search space used: 15120219 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits) S2: 41 (20.6 bits)
- SilkBase 1999-2023 -