BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001825-TA|BGIBMGA001825-PA|IPR006649|Like-Sm ribonucleoprotein, eukaryotic and archaea-type, core, IPR010920|Like-Sm ribonucleoprotein-related, core, IPR001163|Like-Sm ribonucleoprotein, core (139 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value DQ855493-1|ABH88180.1| 127|Tribolium castaneum chemosensory pro... 21 4.1 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 21 5.4 >DQ855493-1|ABH88180.1| 127|Tribolium castaneum chemosensory protein 7 protein. Length = 127 Score = 21.0 bits (42), Expect = 4.1 Identities = 14/62 (22%), Positives = 27/62 (43%) Query: 34 NWMNINLREVICTSRDGDKFWRMPECYIRGSTIKYLRIPDEVIDMVKEETQVKARGRNEV 93 N++ + E CTS + +P+ G T + + +++ TQ +AR + Sbjct: 44 NYIKCLMDEGPCTSEGRELKKTLPDALSSGCTKCNQKQKETAEKVIRHLTQKRARDWERL 103 Query: 94 SK 95 SK Sbjct: 104 SK 105 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 20.6 bits (41), Expect = 5.4 Identities = 5/18 (27%), Positives = 13/18 (72%) Query: 31 SCDNWMNINLREVICTSR 48 +CD N+N+ +++ T++ Sbjct: 1327 TCDGTSNVNVVDIVTTAK 1344 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.318 0.134 0.405 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 26,514 Number of Sequences: 317 Number of extensions: 900 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of query: 139 length of database: 114,650 effective HSP length: 51 effective length of query: 88 effective length of database: 98,483 effective search space: 8666504 effective search space used: 8666504 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.8 bits) S2: 39 (19.8 bits)
- SilkBase 1999-2023 -