BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001822-TA|BGIBMGA001822-PA|IPR010285|Protein of unknown function DUF889, eukaryote (240 letters) Database: mosquito 2123 sequences; 516,269 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY745224-1|AAU93491.1| 103|Anopheles gambiae cytochrome P450 pr... 27 0.37 EF117200-1|ABL67437.1| 421|Anopheles gambiae serpin 1 protein. 23 8.0 >AY745224-1|AAU93491.1| 103|Anopheles gambiae cytochrome P450 protein. Length = 103 Score = 27.5 bits (58), Expect = 0.37 Identities = 11/24 (45%), Positives = 15/24 (62%) Query: 147 DAPRLCNGTRLQVTHLGRNIVKAI 170 D PR+C G R VT + R IV+ + Sbjct: 61 DGPRMCLGMRFAVTQVRRAIVEVV 84 >EF117200-1|ABL67437.1| 421|Anopheles gambiae serpin 1 protein. Length = 421 Score = 23.0 bits (47), Expect = 8.0 Identities = 16/57 (28%), Positives = 23/57 (40%), Gaps = 2/57 (3%) Query: 55 YSELLTNMRNRDWLCERAILAPTNEMVGQINEQIMSRVEGDIVEFLSVDTVMDTEQV 111 Y++LL M ER T +IN G I E ++ DT+ D + V Sbjct: 139 YTDLLEQMYRTS--VERVSFNGTKATAERINTWCEKVTRGRITELVTEDTLQDAQLV 193 Database: mosquito Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 516,269 Number of sequences in database: 2123 Lambda K H 0.321 0.137 0.395 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 225,982 Number of Sequences: 2123 Number of extensions: 9275 Number of successful extensions: 16 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 15 Number of HSP's gapped (non-prelim): 2 length of query: 240 length of database: 516,269 effective HSP length: 62 effective length of query: 178 effective length of database: 384,643 effective search space: 68466454 effective search space used: 68466454 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.9 bits) S2: 47 (23.0 bits)
- SilkBase 1999-2023 -