BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001821-TA|BGIBMGA001821-PA|undefined (161 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_40561| Best HMM Match : Keratin_B2 (HMM E-Value=1.1) 27 5.6 SB_57394| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.4 >SB_40561| Best HMM Match : Keratin_B2 (HMM E-Value=1.1) Length = 1139 Score = 27.5 bits (58), Expect = 5.6 Identities = 19/68 (27%), Positives = 28/68 (41%), Gaps = 2/68 (2%) Query: 5 PETKILIYVEINAHTKSKQFSQFTNLSDVRIKATTLGATVRGANCITESNDGDANTALQP 64 P T + +N HT S S + + T T NC T N G ++ +P Sbjct: 421 PITTTITNHRLNCHTNSVILSSRKRPAPITTTPITTTITNHRLNCHT--NSGILSSRKRP 478 Query: 65 SNVTTVIT 72 + +TT IT Sbjct: 479 APITTTIT 486 Score = 27.5 bits (58), Expect = 5.6 Identities = 19/68 (27%), Positives = 28/68 (41%), Gaps = 2/68 (2%) Query: 5 PETKILIYVEINAHTKSKQFSQFTNLSDVRIKATTLGATVRGANCITESNDGDANTALQP 64 P T + +N HT S S + + T T NC T N G ++ +P Sbjct: 569 PITTTITNHRLNCHTNSVILSSRKRPAPITTTPITTTITNHRLNCHT--NSGILSSRKRP 626 Query: 65 SNVTTVIT 72 + +TT IT Sbjct: 627 APITTTIT 634 >SB_57394| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 442 Score = 27.1 bits (57), Expect = 7.4 Identities = 14/51 (27%), Positives = 26/51 (50%) Query: 19 TKSKQFSQFTNLSDVRIKATTLGATVRGANCITESNDGDANTALQPSNVTT 69 T+S +Q TN++ + T GA+ T +N+ + +L PS +T+ Sbjct: 131 TQSSNVTQSTNVTQAKYVTPTSGASFFAGPVTTLANERNDQRSLIPSAITS 181 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.309 0.124 0.349 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,179,302 Number of Sequences: 59808 Number of extensions: 86239 Number of successful extensions: 144 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 139 Number of HSP's gapped (non-prelim): 6 length of query: 161 length of database: 16,821,457 effective HSP length: 77 effective length of query: 84 effective length of database: 12,216,241 effective search space: 1026164244 effective search space used: 1026164244 T: 11 A: 40 X1: 16 ( 7.1 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.7 bits) S2: 56 (26.6 bits)
- SilkBase 1999-2023 -