BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001821-TA|BGIBMGA001821-PA|undefined (161 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 10_08_0608 + 19184722-19185224,19185331-19185410,19186048-191862... 27 9.5 >10_08_0608 + 19184722-19185224,19185331-19185410,19186048-19186235, 19187021-19187927,19188015-19188142,19189270-19189356, 19189422-19189472,19189582-19189668,19189746-19189873, 19190469-19190608,19190721-19190882,19190964-19192733, 19192807-19192922,19193077-19193227,19193243-19193371, 19193598-19194139 Length = 1722 Score = 26.6 bits (56), Expect = 9.5 Identities = 14/42 (33%), Positives = 23/42 (54%) Query: 7 TKILIYVEINAHTKSKQFSQFTNLSDVRIKATTLGATVRGAN 48 T+IL+ E + T++ Q ++ I ATT+ T+R AN Sbjct: 1613 TQILLAGETLSETRAGIHPQAMRAAEAAILATTMTGTIRAAN 1654 Database: rice Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.309 0.124 0.349 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,823,469 Number of Sequences: 37544 Number of extensions: 75534 Number of successful extensions: 203 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 202 Number of HSP's gapped (non-prelim): 1 length of query: 161 length of database: 14,793,348 effective HSP length: 77 effective length of query: 84 effective length of database: 11,902,460 effective search space: 999806640 effective search space used: 999806640 T: 11 A: 40 X1: 16 ( 7.1 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.7 bits) S2: 56 (26.6 bits)
- SilkBase 1999-2023 -