BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001816-TA|BGIBMGA001816-PA|IPR001878|Zinc finger, CCHC-type, IPR009007|Peptidase aspartic, catalytic (238 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 23 1.6 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 23 1.6 X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. 21 8.4 U09586-2|AAC47271.1| 712|Tribolium castaneum protease, reverse ... 21 8.4 AF236856-1|AAG17563.2| 370|Tribolium castaneum Kruppel protein ... 21 8.4 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 23.4 bits (48), Expect = 1.6 Identities = 13/35 (37%), Positives = 16/35 (45%), Gaps = 2/35 (5%) Query: 122 RSHEKQQTTPIFEHPDTAEGKRAPVTCYKCGVEGH 156 RS E Q T + P+T E + A Y CG H Sbjct: 511 RSDEGPQITEL--EPETIESQDAITRIYACGTMWH 543 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 23.4 bits (48), Expect = 1.6 Identities = 13/35 (37%), Positives = 16/35 (45%), Gaps = 2/35 (5%) Query: 122 RSHEKQQTTPIFEHPDTAEGKRAPVTCYKCGVEGH 156 RS E Q T + P+T E + A Y CG H Sbjct: 511 RSDEGPQITEL--EPETIESQDAITRIYACGTMWH 543 >X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. Length = 524 Score = 21.0 bits (42), Expect = 8.4 Identities = 8/14 (57%), Positives = 8/14 (57%) Query: 141 GKRAPVTCYKCGVE 154 G P TC CGVE Sbjct: 494 GFHNPFTCNMCGVE 507 >U09586-2|AAC47271.1| 712|Tribolium castaneum protease, reverse transcriptase andRNase H protein. Length = 712 Score = 21.0 bits (42), Expect = 8.4 Identities = 9/20 (45%), Positives = 13/20 (65%) Query: 208 DSGADCSLIKESVSRKLVGT 227 D+G++ S I E V KL+ T Sbjct: 105 DTGSEVSCISEEVWSKLIET 124 >AF236856-1|AAG17563.2| 370|Tribolium castaneum Kruppel protein protein. Length = 370 Score = 21.0 bits (42), Expect = 8.4 Identities = 9/20 (45%), Positives = 12/20 (60%), Gaps = 2/20 (10%) Query: 163 KTWSVASNSAQPT--VAPSI 180 KTW V +S PT V+P + Sbjct: 107 KTWKVEEDSPSPTSSVSPEV 126 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.319 0.130 0.391 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 52,770 Number of Sequences: 317 Number of extensions: 2057 Number of successful extensions: 16 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 3 Number of HSP's that attempted gapping in prelim test: 14 Number of HSP's gapped (non-prelim): 5 length of query: 238 length of database: 114,650 effective HSP length: 55 effective length of query: 183 effective length of database: 97,215 effective search space: 17790345 effective search space used: 17790345 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 42 (21.0 bits)
- SilkBase 1999-2023 -