BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001814-TA|BGIBMGA001814-PA|IPR001810|Cyclin-like F-box (684 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 25 2.3 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 25 2.3 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 24.6 bits (51), Expect = 2.3 Identities = 14/38 (36%), Positives = 19/38 (50%), Gaps = 1/38 (2%) Query: 463 NGGGEQNDV-KMDEPRPEAVNQGASTSKDDPQPSTSNK 499 +GGGE + +DE V Q STS ++P S K Sbjct: 1379 SGGGENKPIFYLDEAFQRRVTQIGSTSSNNPSISAFRK 1416 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 24.6 bits (51), Expect = 2.3 Identities = 14/38 (36%), Positives = 19/38 (50%), Gaps = 1/38 (2%) Query: 463 NGGGEQNDV-KMDEPRPEAVNQGASTSKDDPQPSTSNK 499 +GGGE + +DE V Q STS ++P S K Sbjct: 1379 SGGGENKPIFYLDEAFQRRVTQIGSTSSNNPSISAFRK 1416 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.316 0.134 0.405 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 158,935 Number of Sequences: 317 Number of extensions: 7090 Number of successful extensions: 15 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 2 Number of HSP's that attempted gapping in prelim test: 15 Number of HSP's gapped (non-prelim): 2 length of query: 684 length of database: 114,650 effective HSP length: 61 effective length of query: 623 effective length of database: 95,313 effective search space: 59379999 effective search space used: 59379999 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits) S2: 46 (22.6 bits)
- SilkBase 1999-2023 -