BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001812-TA|BGIBMGA001812-PA|IPR002937|Amine oxidase (245 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value AB022907-1|BAA86908.1| 615|Apis mellifera glucose oxidase protein. 26 0.28 DQ151547-1|ABA39280.1| 405|Apis mellifera tyramine receptor pro... 22 4.5 >AB022907-1|BAA86908.1| 615|Apis mellifera glucose oxidase protein. Length = 615 Score = 26.2 bits (55), Expect = 0.28 Identities = 14/33 (42%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Query: 4 TYDTIIVGLGPAGCTAASTLAQAGK-KILALEA 35 +YD I+VG G A A L++ K+L LEA Sbjct: 68 SYDFIVVGGGAARAVVAGRLSEVSNWKVLLLEA 100 >DQ151547-1|ABA39280.1| 405|Apis mellifera tyramine receptor protein. Length = 405 Score = 22.2 bits (45), Expect = 4.5 Identities = 10/24 (41%), Positives = 13/24 (54%) Query: 174 SVGVIAKVAMSFPAKWFPDDIVYL 197 + G +A V F A W P I+YL Sbjct: 304 TAGTLAVVVGGFVACWLPFFILYL 327 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.316 0.134 0.409 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 74,876 Number of Sequences: 429 Number of extensions: 3282 Number of successful extensions: 6 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 5 Number of HSP's gapped (non-prelim): 2 length of query: 245 length of database: 140,377 effective HSP length: 56 effective length of query: 189 effective length of database: 116,353 effective search space: 21990717 effective search space used: 21990717 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits) S2: 43 (21.4 bits)
- SilkBase 1999-2023 -