BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001812-TA|BGIBMGA001812-PA|IPR002937|Amine oxidase (245 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface pro... 31 0.006 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 22 3.8 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 22 3.8 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 22 5.0 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 22 5.0 DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulati... 21 6.6 AY920544-1|AAX62142.1| 463|Tribolium castaneum cytochrome P450 ... 21 6.6 AM292336-1|CAL23148.2| 455|Tribolium castaneum gustatory recept... 21 8.7 >AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface protein chaoptin protein. Length = 782 Score = 31.5 bits (68), Expect = 0.006 Identities = 16/56 (28%), Positives = 28/56 (50%) Query: 60 WNDVTTQTHYVDLEGDQHMSWHRNGYSTLFDILLNTYKGGPGYPNLEIQLNKEVVL 115 WN +++ +H L + +SW Y+ L I T+KG P +L + N ++ L Sbjct: 378 WNSISSLSHGGQLARFKCLSWLDLSYNRLGQIDAGTFKGIPRLASLNLGHNSQLTL 433 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 22.2 bits (45), Expect = 3.8 Identities = 6/17 (35%), Positives = 13/17 (76%) Query: 107 IQLNKEVVLIEWPTDPE 123 + L K+++ ++WP DP+ Sbjct: 1243 LTLKKDLLHLDWPFDPK 1259 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 22.2 bits (45), Expect = 3.8 Identities = 6/17 (35%), Positives = 13/17 (76%) Query: 107 IQLNKEVVLIEWPTDPE 123 + L K+++ ++WP DP+ Sbjct: 1243 LTLKKDLLHLDWPFDPK 1259 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 21.8 bits (44), Expect = 5.0 Identities = 6/13 (46%), Positives = 11/13 (84%) Query: 107 IQLNKEVVLIEWP 119 +QLNK+ + ++WP Sbjct: 1286 LQLNKDQIHVKWP 1298 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 21.8 bits (44), Expect = 5.0 Identities = 6/13 (46%), Positives = 11/13 (84%) Query: 107 IQLNKEVVLIEWP 119 +QLNK+ + ++WP Sbjct: 1286 LQLNKDQIHVKWP 1298 >DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulation protein. Length = 947 Score = 21.4 bits (43), Expect = 6.6 Identities = 13/37 (35%), Positives = 17/37 (45%) Query: 22 TLAQAGKKILALEAQNRIGGRVKTVPFGDGVIELGAE 58 TLA A K L+ R + FG V ELG++ Sbjct: 12 TLATARNKAPLLDDGTRTRNKAAECVFGKQVRELGSQ 48 >AY920544-1|AAX62142.1| 463|Tribolium castaneum cytochrome P450 monooxygenase protein. Length = 463 Score = 21.4 bits (43), Expect = 6.6 Identities = 7/24 (29%), Positives = 13/24 (54%) Query: 11 GLGPAGCTAASTLAQAGKKILALE 34 G+GP C A + GK ++ ++ Sbjct: 418 GVGPRNCIAKFDIVPNGKTVIPIK 441 >AM292336-1|CAL23148.2| 455|Tribolium castaneum gustatory receptor candidate 15 protein. Length = 455 Score = 21.0 bits (42), Expect = 8.7 Identities = 9/16 (56%), Positives = 13/16 (81%) Query: 78 MSWHRNGYSTLFDILL 93 M+ R+ +STLF+ILL Sbjct: 88 MTLKRHKWSTLFEILL 103 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.316 0.134 0.409 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 60,032 Number of Sequences: 317 Number of extensions: 2455 Number of successful extensions: 8 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of query: 245 length of database: 114,650 effective HSP length: 55 effective length of query: 190 effective length of database: 97,215 effective search space: 18470850 effective search space used: 18470850 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits) S2: 42 (21.0 bits)
- SilkBase 1999-2023 -