BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001810-TA|BGIBMGA001810-PA|IPR001849|Pleckstrin-like, IPR000648|Oxysterol-binding protein (478 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value AY338499-1|AAR08420.1| 500|Apis mellifera Kruppel-like protein ... 27 0.46 AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ... 27 0.46 >AY338499-1|AAR08420.1| 500|Apis mellifera Kruppel-like protein 1 protein. Length = 500 Score = 26.6 bits (56), Expect = 0.46 Identities = 14/59 (23%), Positives = 27/59 (45%), Gaps = 3/59 (5%) Query: 397 PSVERFARCCSSTSDDEFQRN---GDDVSRFNSTPEKYSLIDYVNSPSANLEMVTNEKR 452 P +E S+ SD E + D+V+ +++TP + Y + +++NE R Sbjct: 298 PEIEISQNSVSTGSDKENHKTEEPNDEVATYDNTPRDFPYYMYSREQYSQSHLISNENR 356 >AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein protein. Length = 1124 Score = 26.6 bits (56), Expect = 0.46 Identities = 19/83 (22%), Positives = 38/83 (45%), Gaps = 4/83 (4%) Query: 319 VKMSPSLDDGLLKLVTSSRKRRSSTPGNMLRLNRSPVFRRSGARTDSENEDVPKKLLSDK 378 +K S L D +K + ++ S+ P ++N+S +RSG+ + + K Sbjct: 666 IKASDKLKDSRIK----TTEKLSTDPNTHFQVNQSHGIKRSGSHSWEGDSFKVSKHEEVS 721 Query: 379 RSEILCDTPDNILITRTAPSVER 401 R+ P N+ T T+ S+++ Sbjct: 722 RTSTAGQFPTNVATTVTSMSIDQ 744 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.315 0.130 0.388 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 127,004 Number of Sequences: 429 Number of extensions: 5382 Number of successful extensions: 8 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 6 Number of HSP's gapped (non-prelim): 3 length of query: 478 length of database: 140,377 effective HSP length: 60 effective length of query: 418 effective length of database: 114,637 effective search space: 47918266 effective search space used: 47918266 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits) S2: 45 (22.2 bits)
- SilkBase 1999-2023 -