BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001810-TA|BGIBMGA001810-PA|IPR001849|Pleckstrin-like, IPR000648|Oxysterol-binding protein (478 letters) Database: mosquito 2123 sequences; 516,269 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR954257-1|CAJ14152.1| 324|Anopheles gambiae putative dodecenoy... 25 5.9 AF117751-1|AAD38337.3| 1322|Anopheles gambiae serine protease 22... 24 7.8 >CR954257-1|CAJ14152.1| 324|Anopheles gambiae putative dodecenoylCoA deltaisomerase protein. Length = 324 Score = 24.6 bits (51), Expect = 5.9 Identities = 15/30 (50%), Positives = 17/30 (56%), Gaps = 3/30 (10%) Query: 123 PTAHLIFRAPSQAA--GHCWLDGLELALRC 150 PT +I R P A G+C GLELAL C Sbjct: 133 PTRRMI-RKPLVCAITGYCVAGGLELALMC 161 >AF117751-1|AAD38337.3| 1322|Anopheles gambiae serine protease 22D protein. Length = 1322 Score = 24.2 bits (50), Expect = 7.8 Identities = 9/21 (42%), Positives = 13/21 (61%) Query: 63 SPKAKSSHWVGTVLLTSCQVI 83 S + K+ HW G VL+T V+ Sbjct: 1095 SLRVKTMHWCGAVLITRYHVL 1115 Database: mosquito Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 516,269 Number of sequences in database: 2123 Lambda K H 0.315 0.130 0.388 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 447,959 Number of Sequences: 2123 Number of extensions: 16994 Number of successful extensions: 27 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 26 Number of HSP's gapped (non-prelim): 2 length of query: 478 length of database: 516,269 effective HSP length: 67 effective length of query: 411 effective length of database: 374,028 effective search space: 153725508 effective search space used: 153725508 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits) S2: 50 (24.2 bits)
- SilkBase 1999-2023 -