BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001805-TA|BGIBMGA001805-PA|undefined (343 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase ... 23 2.9 AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice... 22 6.7 AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter... 22 8.9 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 22 8.9 >DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase isoform A protein. Length = 969 Score = 23.4 bits (48), Expect = 2.9 Identities = 9/26 (34%), Positives = 18/26 (69%) Query: 278 YLRVKNELKIMNDEEYKAFDISQIEN 303 YLR +N+L+ + +E +A ++ +EN Sbjct: 12 YLRNRNQLQHVLEETQQALELINLEN 37 >AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice variant B protein. Length = 810 Score = 22.2 bits (45), Expect = 6.7 Identities = 14/37 (37%), Positives = 19/37 (51%), Gaps = 2/37 (5%) Query: 254 EKTEDDMEYYDWDNNASK-RSLIDWYLRVKNELKIMN 289 E +D++ W+N S R+L D Y VKN L N Sbjct: 373 EYNNNDLDTKKWNNKISALRALNDLY-NVKNTLDSYN 408 >AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 593 Score = 21.8 bits (44), Expect = 8.9 Identities = 13/55 (23%), Positives = 20/55 (36%), Gaps = 1/55 (1%) Query: 78 WGNV-WPGPKTFHPSSVPLPIRQGYVPKGQAPPGKKANAELMKIPNFLHLTPPVI 131 W V W G + S P + + +G PG + PN L+ P + Sbjct: 225 WKGVKWTGKVVYFTSLFPYALLTILLIRGLTLPGAMEGLKYYVTPNLSKLSDPEV 279 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 21.8 bits (44), Expect = 8.9 Identities = 13/55 (23%), Positives = 20/55 (36%), Gaps = 1/55 (1%) Query: 78 WGNV-WPGPKTFHPSSVPLPIRQGYVPKGQAPPGKKANAELMKIPNFLHLTPPVI 131 W V W G + S P + + +G PG + PN L+ P + Sbjct: 278 WKGVKWTGKVVYFTSLFPYALLTILLIRGLTLPGAMEGLKYYVTPNLSKLSDPEV 332 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.316 0.133 0.403 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 107,093 Number of Sequences: 429 Number of extensions: 5564 Number of successful extensions: 6 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 3 Number of HSP's that attempted gapping in prelim test: 5 Number of HSP's gapped (non-prelim): 4 length of query: 343 length of database: 140,377 effective HSP length: 58 effective length of query: 285 effective length of database: 115,495 effective search space: 32916075 effective search space used: 32916075 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits) S2: 44 (21.8 bits)
- SilkBase 1999-2023 -