BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001803-TA|BGIBMGA001803-PA|IPR011356|Peptidase M17, leucyl aminopeptidase, IPR000819|Peptidase M17, leucyl aminopeptidase, C-terminal (510 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value DQ659252-1|ABG47450.1| 377|Tribolium castaneum chitinase 13 pro... 28 0.13 AY873913-1|AAW67569.2| 377|Tribolium castaneum chitinase 2 prot... 23 6.7 >DQ659252-1|ABG47450.1| 377|Tribolium castaneum chitinase 13 protein. Length = 377 Score = 28.3 bits (60), Expect = 0.13 Identities = 18/67 (26%), Positives = 36/67 (53%), Gaps = 1/67 (1%) Query: 369 TAAQELNPHLYTIATLTGHARACYGNYVAAMDNHSARATNHSTRLQFSGTRVSEPIEVSY 428 +A +E NP+L + ++ G A A ++VAA ++ S+ ++F T + ++V + Sbjct: 86 SALKEKNPNLKVMLSVGG-ATASPDSFVAAANDPEKMKNMTSSAIEFFETYNYDGLDVDW 144 Query: 429 VRPEDLA 435 P+D A Sbjct: 145 EYPQDKA 151 >AY873913-1|AAW67569.2| 377|Tribolium castaneum chitinase 2 protein. Length = 377 Score = 22.6 bits (46), Expect = 6.7 Identities = 11/22 (50%), Positives = 16/22 (72%), Gaps = 1/22 (4%) Query: 366 FAETAA-QELNPHLYTIATLTG 386 FAE A +E+NP+L TI ++ G Sbjct: 83 FAEVEALKEINPNLKTIISIGG 104 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.319 0.135 0.394 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 107,044 Number of Sequences: 317 Number of extensions: 4235 Number of successful extensions: 5 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 4 Number of HSP's gapped (non-prelim): 2 length of query: 510 length of database: 114,650 effective HSP length: 60 effective length of query: 450 effective length of database: 95,630 effective search space: 43033500 effective search space used: 43033500 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits) S2: 45 (22.2 bits)
- SilkBase 1999-2023 -