GeneModel BLAST Result against bee

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA001803-TA|BGIBMGA001803-PA|IPR011356|Peptidase M17,
leucyl aminopeptidase, IPR000819|Peptidase M17, leucyl aminopeptidase,
C-terminal
         (510 letters)

Database: bee 
           429 sequences; 140,377 total letters

Searching.....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AJ968562-1|CAI91546.1|  998|Apis mellifera protein ( Apis mellif...    24   3.4  

>AJ968562-1|CAI91546.1|  998|Apis mellifera protein ( Apis mellifera
           ORF for hypotheticalprotein. ).
          Length = 998

 Score = 23.8 bits (49), Expect = 3.4
 Identities = 14/68 (20%), Positives = 34/68 (50%), Gaps = 1/68 (1%)

Query: 3   FVEYKLYENIFIETNLQSADYDAVILILYPEELNVPLPRHIGSFVD-GIGKLDKHIHKSA 61
           F+E +    + +    QS + + ++L + PE + V + + +G+ +D    K+    H++ 
Sbjct: 213 FLETRQSLEVQLVIEEQSTEQERLLLSVLPEHVAVKMRQDLGASLDTQFKKIYMSRHENV 272

Query: 62  TVWQCDYV 69
           ++   D V
Sbjct: 273 SILYADIV 280


  Database: bee
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 140,377
  Number of sequences in database:  429
  
Lambda     K      H
   0.319    0.135    0.394 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 130,741
Number of Sequences: 429
Number of extensions: 5198
Number of successful extensions: 56
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 56
Number of HSP's gapped (non-prelim): 1
length of query: 510
length of database: 140,377
effective HSP length: 61
effective length of query: 449
effective length of database: 114,208
effective search space: 51279392
effective search space used: 51279392
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
S2: 46 (22.6 bits)