BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001802-TA|BGIBMGA001802-PA|undefined (706 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 prot... 23 9.5 DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad... 23 9.5 >DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 protein. Length = 980 Score = 22.6 bits (46), Expect = 9.5 Identities = 9/24 (37%), Positives = 13/24 (54%) Query: 304 GHVSTMTSVSLTAVNQNDAYERLC 327 GH T S+S T+ D Y+ +C Sbjct: 68 GHRKTDNSLSATSKKDKDGYKVVC 91 >DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome adhesion molecule splicevariant 3.12.3.1 protein. Length = 1639 Score = 22.6 bits (46), Expect = 9.5 Identities = 13/44 (29%), Positives = 18/44 (40%) Query: 255 APHTAIPIVSTEDVFDFDVNRKTPNFVNIVNTEVNVQNTNDYGT 298 A H +V D +NRK F+N NV+ +D T Sbjct: 535 AGHPVDSVVWERDGRQLPINRKQKVFINGTLIIENVERASDQAT 578 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.313 0.129 0.377 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 141,758 Number of Sequences: 317 Number of extensions: 5670 Number of successful extensions: 9 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 7 Number of HSP's gapped (non-prelim): 2 length of query: 706 length of database: 114,650 effective HSP length: 62 effective length of query: 644 effective length of database: 94,996 effective search space: 61177424 effective search space used: 61177424 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.9 bits) S2: 46 (22.6 bits)
- SilkBase 1999-2023 -