BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001801-TA|BGIBMGA001801-PA|IPR010339|TIP49, C-terminal (408 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value AB204559-1|BAD89804.1| 832|Apis mellifera soluble guanylyl cycl... 23 6.2 AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase... 23 6.2 >AB204559-1|BAD89804.1| 832|Apis mellifera soluble guanylyl cyclase beta-3 protein. Length = 832 Score = 22.6 bits (46), Expect = 6.2 Identities = 14/49 (28%), Positives = 22/49 (44%) Query: 331 TRVATETSLRYAIQLITTASLVAKRRKAAEVSMEDVKKVYSLFLDEHRS 379 T A + + + + + + S K R EV + + K Y L EHRS Sbjct: 554 TSQAMQIHISQSTKELLSPSYRVKERGEIEVKGKGIMKTYWLEKREHRS 602 >AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase protein. Length = 1143 Score = 22.6 bits (46), Expect = 6.2 Identities = 9/23 (39%), Positives = 14/23 (60%), Gaps = 1/23 (4%) Query: 374 LDEHR-SEQFLKEYQDEFMFNDG 395 +D H SE F+K Y++E +G Sbjct: 360 VDHHTASESFMKHYENEMRLRNG 382 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.317 0.131 0.358 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 83,705 Number of Sequences: 429 Number of extensions: 2904 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 2 Number of HSP's gapped (non-prelim): 2 length of query: 408 length of database: 140,377 effective HSP length: 59 effective length of query: 349 effective length of database: 115,066 effective search space: 40158034 effective search space used: 40158034 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits) S2: 45 (22.2 bits)
- SilkBase 1999-2023 -