BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001798-TA|BGIBMGA001798-PA|undefined (905 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value EF222294-1|ABN79654.1| 451|Tribolium castaneum ecdysis triggeri... 26 1.0 EF222293-1|ABN79653.1| 434|Tribolium castaneum ecdysis triggeri... 26 1.0 AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor ... 24 5.3 AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr... 23 9.3 >EF222294-1|ABN79654.1| 451|Tribolium castaneum ecdysis triggering hormone receptorisoform B protein. Length = 451 Score = 26.2 bits (55), Expect = 1.0 Identities = 13/25 (52%), Positives = 17/25 (68%), Gaps = 2/25 (8%) Query: 435 LYPPNDAPQIDLYDTDSVSSFSAES 459 LY P+ IDLY+T SVS+F+ S Sbjct: 37 LYTPSST--IDLYNTSSVSNFNESS 59 >EF222293-1|ABN79653.1| 434|Tribolium castaneum ecdysis triggering hormone receptorisoform A protein. Length = 434 Score = 26.2 bits (55), Expect = 1.0 Identities = 13/25 (52%), Positives = 17/25 (68%), Gaps = 2/25 (8%) Query: 435 LYPPNDAPQIDLYDTDSVSSFSAES 459 LY P+ IDLY+T SVS+F+ S Sbjct: 37 LYTPSST--IDLYNTSSVSNFNESS 59 >AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor protein protein. Length = 585 Score = 23.8 bits (49), Expect = 5.3 Identities = 9/16 (56%), Positives = 12/16 (75%), Gaps = 1/16 (6%) Query: 774 GRTGQDCAQYV-WSAT 788 G TG+DC +YV W +T Sbjct: 90 GYTGKDCGEYVDWCST 105 >AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like protein protein. Length = 1156 Score = 23.0 bits (47), Expect = 9.3 Identities = 14/51 (27%), Positives = 20/51 (39%) Query: 107 DEKMETTSLATTRAMEDYDYVSSKAPESDGDQEVDGQGNPKTDGSEQTLAE 157 + KME + K+P SD QE DG+ K + E+ E Sbjct: 827 ERKMEPPGVPLNSTPRSTPDKREKSPTSDKAQEADGEVVVKKEVDEEERLE 877 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.313 0.130 0.370 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 191,805 Number of Sequences: 317 Number of extensions: 8324 Number of successful extensions: 19 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 16 Number of HSP's gapped (non-prelim): 4 length of query: 905 length of database: 114,650 effective HSP length: 63 effective length of query: 842 effective length of database: 94,679 effective search space: 79719718 effective search space used: 79719718 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.9 bits) S2: 47 (23.0 bits)
- SilkBase 1999-2023 -