BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001797-TA|BGIBMGA001797-PA|IPR002737|Protein of unknown function DUF52 (304 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase... 23 4.4 >AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase protein. Length = 1143 Score = 22.6 bits (46), Expect = 4.4 Identities = 12/50 (24%), Positives = 25/50 (50%) Query: 143 PYIAKVMEEYKTSFTIIPILVGSLTPEKEAKYGAILAPYLADPQNLLVIS 192 P + +V++E+ + P+L+ LTP + Y +P + Q L ++ Sbjct: 868 PNLVEVLDEFPSVRPFAPLLLLHLTPLQPRFYSISSSPDVHQGQIHLTVA 917 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.321 0.137 0.412 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 77,357 Number of Sequences: 429 Number of extensions: 3027 Number of successful extensions: 1 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1 length of query: 304 length of database: 140,377 effective HSP length: 57 effective length of query: 247 effective length of database: 115,924 effective search space: 28633228 effective search space used: 28633228 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.9 bits) S2: 44 (21.8 bits)
- SilkBase 1999-2023 -