BLASTP 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= BGIBMGA001797-TA|BGIBMGA001797-PA|IPR002737|Protein of unknown
function DUF52
(304 letters)
Database: bee
429 sequences; 140,377 total letters
Searching.....................................................done
Score E
Sequences producing significant alignments: (bits) Value
AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase... 23 4.4
>AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase
protein.
Length = 1143
Score = 22.6 bits (46), Expect = 4.4
Identities = 12/50 (24%), Positives = 25/50 (50%)
Query: 143 PYIAKVMEEYKTSFTIIPILVGSLTPEKEAKYGAILAPYLADPQNLLVIS 192
P + +V++E+ + P+L+ LTP + Y +P + Q L ++
Sbjct: 868 PNLVEVLDEFPSVRPFAPLLLLHLTPLQPRFYSISSSPDVHQGQIHLTVA 917
Database: bee
Posted date: Oct 5, 2007 11:13 AM
Number of letters in database: 140,377
Number of sequences in database: 429
Lambda K H
0.321 0.137 0.412
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 77,357
Number of Sequences: 429
Number of extensions: 3027
Number of successful extensions: 1
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1
length of query: 304
length of database: 140,377
effective HSP length: 57
effective length of query: 247
effective length of database: 115,924
effective search space: 28633228
effective search space used: 28633228
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.9 bits)
S2: 44 (21.8 bits)
- SilkBase 1999-2023 -