GeneModel BLAST Result against spombe

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA001790-TA|BGIBMGA001790-PA|IPR011028|Cyclin-like,
IPR006671|Cyclin, N-terminal
         (361 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPAC25G10.03 |zip1||transcription factor Zip1|Schizosaccharomyce...    26   9.5  

>SPAC25G10.03 |zip1||transcription factor Zip1|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 330

 Score = 25.8 bits (54), Expect = 9.5
 Identities = 13/35 (37%), Positives = 22/35 (62%)

Query: 13  ECRSPVASTSRDDVDSAQQLYATLNEYLLLEQKSQ 47
           E +S VAS S+D+V S+  L  + +  LL +Q ++
Sbjct: 148 EQKSSVASASKDNVSSSSILQGSASSKLLPDQSAR 182


  Database: spombe
    Posted date:  Oct 3, 2007  3:31 PM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.320    0.131    0.387 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 1,279,563
Number of Sequences: 5004
Number of extensions: 42920
Number of successful extensions: 95
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 94
Number of HSP's gapped (non-prelim): 1
length of query: 361
length of database: 2,362,478
effective HSP length: 74
effective length of query: 287
effective length of database: 1,992,182
effective search space: 571756234
effective search space used: 571756234
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.9 bits)
S2: 54 (25.8 bits)