BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001789-TA|BGIBMGA001789-PA|IPR011011|Zinc finger, FYVE/PHD-type, IPR001841|Zinc finger, RING-type, IPR001965|Zinc finger, PHD-type (760 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_04_0487 - 25585229-25585540,25585627-25585745,25586029-255861... 56 8e-08 01_06_0192 + 27347369-27348826,27349124-27349264,27349350-273510... 52 2e-06 05_05_0278 - 23786507-23786875,23787191-23787315,23787499-237876... 46 1e-04 05_06_0046 - 25157093-25157431,25157810-25157928,25158024-251581... 43 0.001 08_02_0655 + 19738334-19739385,19739501-19739745,19740094-19740119 36 0.091 08_01_0331 + 2966362-2966477,2966561-2966924,2966949-2967050,296... 35 0.21 06_01_0747 - 5587261-5587356,5587472-5587855,5588133-5588192,558... 34 0.48 10_04_0022 + 7687383-7687670,7688479-7688556,7689456-7689535,768... 33 1.1 06_01_0778 + 5816588-5816885,5817554-5817615,5818764-5818905,581... 32 1.5 05_04_0339 + 20397591-20397627,20398494-20398526,20399210-203994... 32 1.5 04_04_0015 + 22164889-22165000,22165135-22165167,22165992-221662... 32 1.5 08_01_0418 - 3716226-3716279,3716531-3716581,3716656-3716751,371... 32 2.0 02_05_0877 + 32403363-32404662,32406545-32406630,32406709-324070... 32 2.0 11_01_0334 + 2495275-2495433,2495553-2495661,2496311-2496378,249... 31 2.6 05_01_0459 - 3637741-3637995,3638078-3638204,3641273-3641495,364... 31 2.6 07_03_1219 + 24960043-24960133,24960304-24960336,24962258-249624... 31 3.4 07_01_0891 - 7447079-7447330,7447431-7447554,7449571-7449793,744... 31 3.4 08_02_0266 + 15051868-15052286,15052376-15052475,15053540-150535... 31 4.5 02_04_0516 + 23593088-23593116,23593209-23593336,23593527-235937... 31 4.5 02_04_0461 - 23125260-23125868 31 4.5 02_04_0268 + 21435231-21435240,21435330-21435558,21435778-214358... 31 4.5 09_06_0244 + 21822811-21823246,21823337-21823468,21823949-218240... 30 6.0 08_02_0703 - 20188489-20190246 30 6.0 01_01_1206 - 9702128-9702184,9702272-9702323,9702410-9702471,970... 30 6.0 01_01_0401 + 3043634-3043894,3045610-3045849 30 6.0 03_06_0561 + 34728428-34728439,34728529-34728615,34728729-347287... 30 7.9 03_06_0465 - 34130083-34130340,34130421-34130541,34131158-341311... 30 7.9 01_06_1602 - 38559661-38559936,38560008-38560137,38562550-385627... 30 7.9 >04_04_0487 - 25585229-25585540,25585627-25585745,25586029-25586194, 25586295-25586427,25586527-25586618,25586739-25586925, 25587183-25587271,25587318-25587379,25587462-25587567, 25587754-25588052,25588181-25588288,25588369-25588439, 25588792-25588871 Length = 607 Score = 56.4 bits (130), Expect = 8e-08 Identities = 26/69 (37%), Positives = 34/69 (49%) Query: 70 GFLYRDILAEIERAKKHKCSYCSRGGATLGCSVSQCRKQFHLPCGREKNAVSLFYGNYKS 129 G + ++ E+ RA K KCS C GA LGC V CRK FH+PC + N+ Sbjct: 280 GDIANNLEPELARASKIKCSVCGLKGAALGCLVKSCRKSFHVPCAHGISGCRWDDENFVM 339 Query: 130 YCQQHVPKQ 138 C H K+ Sbjct: 340 LCPSHSSKK 348 >01_06_0192 + 27347369-27348826,27349124-27349264,27349350-27351081, 27353739-27354606,27354784-27355957 Length = 1790 Score = 52.0 bits (119), Expect = 2e-06 Identities = 20/47 (42%), Positives = 30/47 (63%) Query: 74 RDILAEIERAKKHKCSYCSRGGATLGCSVSQCRKQFHLPCGREKNAV 120 +++ A + R + KCS C R GAT+GC V +C K +HLPC R + + Sbjct: 496 KNVRAALCRGRLLKCSRCGRPGATIGCRVDRCPKTYHLPCSRAEACI 542 >05_05_0278 - 23786507-23786875,23787191-23787315,23787499-23787664, 23787844-23787979,23788286-23788378,23788505-23788611, 23788719-23788905,23789616-23789722,23789811-23790065, 23791241-23791306,23791363-23791401 Length = 549 Score = 46.0 bits (104), Expect = 1e-04 Identities = 17/35 (48%), Positives = 23/35 (65%) Query: 79 EIERAKKHKCSYCSRGGATLGCSVSQCRKQFHLPC 113 EI+RA K KC C GA LGC ++C + +H+PC Sbjct: 173 EIKRAAKLKCKRCKLPGAALGCYYTKCNRSYHVPC 207 >05_06_0046 - 25157093-25157431,25157810-25157928,25158024-25158189, 25158289-25158415,25158490-25158590,25158719-25158905, 25159000-25159100,25159220-25160194,25160325-25160423, 25160500-25160972,25161307-25161420,25161830-25161900, 25162015-25162086,25162334-25162377 Length = 995 Score = 42.7 bits (96), Expect = 0.001 Identities = 15/41 (36%), Positives = 24/41 (58%) Query: 75 DILAEIERAKKHKCSYCSRGGATLGCSVSQCRKQFHLPCGR 115 ++ E+ R+++ KC+ C GA LGC CR+ FH C + Sbjct: 663 NLTTELARSRRIKCACCGIKGAALGCFEMSCRRSFHFTCAK 703 >08_02_0655 + 19738334-19739385,19739501-19739745,19740094-19740119 Length = 440 Score = 36.3 bits (80), Expect = 0.091 Identities = 20/60 (33%), Positives = 35/60 (58%), Gaps = 3/60 (5%) Query: 661 RIDKKKKRDHKELNKSKVYRKNERQKMKIRFKTRIKLKVCESKDKDLKQYVLSNVNNVVV 720 R KKKK+ K+ K K +K +++K K+RF ++CE+ + K Y+L VN++ + Sbjct: 372 RKKKKKKKKKKKKKKKKKKKKKKKKKKKLRFVMIFFYQLCETVE---KMYLLWFVNHLAL 428 >08_01_0331 + 2966362-2966477,2966561-2966924,2966949-2967050, 2967127-2967209,2967306-2967422,2968085-2968187, 2968259-2968928,2969239-2969393,2969529-2969580, 2969734-2969825 Length = 617 Score = 35.1 bits (77), Expect = 0.21 Identities = 18/53 (33%), Positives = 23/53 (43%), Gaps = 4/53 (7%) Query: 178 VCLICYEEVEPYPGVQTFWPPCCARDAWFHRRCLQRMA--LTAGMHYLKCPLC 228 VC ICYE++ P P C FH CL++ G L CP+C Sbjct: 9 VCTICYEDLRPLSDQHLHCLPACGH--VFHALCLEQWLEYCPGGKKKLTCPIC 59 >06_01_0747 - 5587261-5587356,5587472-5587855,5588133-5588192, 5588428-5588484,5588663-5588800,5588901-5588966, 5589234-5589452,5589522-5589737,5589813-5589884, 5589952-5590205,5590356-5590525,5590840-5591029, 5592211-5592331,5592838-5592921,5593003-5593365, 5594530-5594724,5594938-5595933,5596329-5596370 Length = 1240 Score = 33.9 bits (74), Expect = 0.48 Identities = 34/127 (26%), Positives = 48/127 (37%), Gaps = 10/127 (7%) Query: 23 CAICGREVDDEVLYGKIYAIGDIQCHYFCVLLSCCLVQKGRETDGLFGFLYRDILAEIER 82 C +C D V + G C C L C G + G AE Sbjct: 921 CELCQEMPSDVVAGSQSDCDGSKPCLLQCDL---CHGTSGAFRKTIKGRCIHAFCAEESL 977 Query: 83 AK-KHKCSYCSRG-GATLGCSVSQCRKQFHLPCGREKNAV--SLFYGN---YKSYCQQHV 135 K K C+ C R G+ L CS C+ FH C R+ + G+ +K+YC +H Sbjct: 978 PKDKDTCAICHRNVGSCLKCSTVDCQITFHPTCARDAGFYMDTKTIGSTLEHKAYCGKHG 1037 Query: 136 PKQKVHD 142 +Q+ D Sbjct: 1038 IEQRKAD 1044 >10_04_0022 + 7687383-7687670,7688479-7688556,7689456-7689535, 7689876-7690095,7690444-7690677 Length = 299 Score = 32.7 bits (71), Expect = 1.1 Identities = 23/113 (20%), Positives = 55/113 (48%), Gaps = 4/113 (3%) Query: 402 KPTVLKNIEQNLLSPIK-LLEKGVQEKINSEEIDNVIIDEKILEEVREKFRKPKPLCVKR 460 K LK +E+ L ++ + K V++++NSE+I N I ++ E +++ F + K Sbjct: 152 KEAELKLLEEELARRVEESIRKNVEDRLNSEDIKNE-IKRRVEEGIKQLFDEVDAQLQKE 210 Query: 461 KIVDEILQGLFDTVLKESKQKEIIKKWCSPKKREIKEETEPQDIISEDTAVAR 513 K + L+ +E +++E + + +R+++E + + + + R Sbjct: 211 K--ETALREARHKAEQERREREELDRMLEENRRKVEEAQRKEALEQQQKELER 261 >06_01_0778 + 5816588-5816885,5817554-5817615,5818764-5818905, 5819969-5820064,5820147-5820266,5820401-5820663, 5821507-5821617 Length = 363 Score = 32.3 bits (70), Expect = 1.5 Identities = 23/69 (33%), Positives = 38/69 (55%), Gaps = 3/69 (4%) Query: 430 SEEIDNVIIDEKILEEVREKFRKPKPLCVKRKIVDEILQGLFD--TVLKESKQKEIIKKW 487 SEE + V EK+ EK RK PL +K+K+ EIL+ + D ++Q+E ++ W Sbjct: 115 SEERNKVKKLEKVFAR-EEKRRKELPLELKQKVSYEILERMRDLGENSNTTEQREALESW 173 Query: 488 CSPKKREIK 496 K ++I+ Sbjct: 174 RLEKLKDIR 182 >05_04_0339 + 20397591-20397627,20398494-20398526,20399210-20399438, 20402055-20402184,20402251-20402532 Length = 236 Score = 32.3 bits (70), Expect = 1.5 Identities = 13/42 (30%), Positives = 22/42 (52%), Gaps = 1/42 (2%) Query: 191 GVQTFWPPCCARDAWFHRRCLQ-RMALTAGMHYLKCPLCNDK 231 G FW C + + W+H +C++ A + + KCP C +K Sbjct: 191 GKDEFWICCDSCERWYHGKCVKITPARAEHIKHYKCPDCGNK 232 >04_04_0015 + 22164889-22165000,22165135-22165167,22165992-22166220, 22166709-22166826,22166910-22167188 Length = 256 Score = 32.3 bits (70), Expect = 1.5 Identities = 13/38 (34%), Positives = 21/38 (55%), Gaps = 1/38 (2%) Query: 195 FWPPCCARDAWFHRRCLQ-RMALTAGMHYLKCPLCNDK 231 FW C + WFH +C++ A + + KCP C++K Sbjct: 215 FWICCDICETWFHGKCVRITPAKAEHIKHYKCPGCSNK 252 >08_01_0418 - 3716226-3716279,3716531-3716581,3716656-3716751, 3717037-3717194,3717303-3717417,3717511-3717564, 3717843-3717950,3718494-3718583,3718818-3718856, 3718993-3719172,3719264-3719576,3719659-3719834 Length = 477 Score = 31.9 bits (69), Expect = 2.0 Identities = 33/150 (22%), Positives = 62/150 (41%), Gaps = 3/150 (2%) Query: 351 VMPSRMSLRRTKTDPKNVPSTSTAENKQGIMKVTRQDLNLKPPRKPQYCLIKPTVLKNIE 410 ++ S L+R + K + K V + L+ K L K + Sbjct: 258 IVESPEKLQRALEEKKTARAELKNAEKIATQSVQEKTATLEIYSKGYEKLSKHSTKIQAL 317 Query: 411 QNLLSPIKLLEKGVQE---KINSEEIDNVIIDEKILEEVREKFRKPKPLCVKRKIVDEIL 467 Q ++ K LEK V+ KI+ E ++ + +D KI+E + + + K K D+I+ Sbjct: 318 QEQVTATKALEKEVKARKTKISDESVEIMALDTKIIEWDGKVHEMEEHVKAKEKKKDQIV 377 Query: 468 QGLFDTVLKESKQKEIIKKWCSPKKREIKE 497 + S + E K P++R+++E Sbjct: 378 ADENQKLAALSSEVEWKLKCLEPRERKVEE 407 >02_05_0877 + 32403363-32404662,32406545-32406630,32406709-32407077, 32407174-32407257,32407362-32407784,32408368-32408434, 32409238-32409430,32409577-32409680,32409787-32409990, 32410174-32410427,32410511-32410735,32410812-32411033, 32411109-32411162,32411337-32411402,32411496-32411633, 32411979-32412032,32412334-32412393,32412975-32413340, 32413415-32413582 Length = 1478 Score = 31.9 bits (69), Expect = 2.0 Identities = 20/64 (31%), Positives = 27/64 (42%), Gaps = 6/64 (9%) Query: 85 KHKCSYCSRG-GATLGCSVSQCRKQFHLPCGREKNAVSLFYGN-----YKSYCQQHVPKQ 138 K C C GA L C+ C+ FH C R G+ +K+YC +H +Q Sbjct: 1202 KDTCCVCLHTVGACLKCNNGDCQTTFHPYCARHAGFYMNTKGSGGILQHKAYCSKHSIEQ 1261 Query: 139 KVHD 142 K D Sbjct: 1262 KEAD 1265 Score = 31.1 bits (67), Expect = 3.4 Identities = 18/62 (29%), Positives = 26/62 (41%), Gaps = 8/62 (12%) Query: 81 ERAKKHKCSYCS-RGGATLGCSVSQCRKQFHLPCGREKNAVSLFYGNY-------KSYCQ 132 E K CS C + G + CS CR FH C RE +G + +++C Sbjct: 411 ENQWKLVCSICKVKHGVCVRCSHGTCRTPFHPICARESKHQMEIWGKFGYPNVELRAFCS 470 Query: 133 QH 134 +H Sbjct: 471 KH 472 >11_01_0334 + 2495275-2495433,2495553-2495661,2496311-2496378, 2496476-2496577,2496853-2497003,2497173-2497222, 2497432-2497557,2497761-2497863,2498104-2498204, 2498540-2498677,2498768-2498911,2499028-2499103, 2499224-2499309,2499432-2499560,2500572-2500674, 2500776-2500843,2500912-2501013,2501432-2501527, 2501723-2501848,2502152-2502254,2502427-2502569, 2503017-2503154,2503248-2503391,2503535-2503610, 2503883-2503968,2504135-2504212,2505180-2505254, 2505362-2505496,2506240-2506272,2507886-2507905, 2508570-2508666,2508899-2509000,2510612-2510725 Length = 1126 Score = 31.5 bits (68), Expect = 2.6 Identities = 19/91 (20%), Positives = 44/91 (48%), Gaps = 1/91 (1%) Query: 416 PIKLLEKGVQEKINSEEIDNV-IIDEKILEEVREKFRKPKPLCVKRKIVDEILQGLFDTV 474 P +L G+Q+ ID + I+ E++ V + + KP + + V+E + D + Sbjct: 187 PTVILLAGLQDVYRPAAIDQLTILGEQVGVPVYSEGTEAKPAQITKNAVEEAKRKNIDAI 246 Query: 475 LKESKQKEIIKKWCSPKKREIKEETEPQDII 505 + ++ + I K + +E+K+ P +++ Sbjct: 247 VMDTAGRLQIDKSMMVELKEVKKAVNPTEVL 277 >05_01_0459 - 3637741-3637995,3638078-3638204,3641273-3641495, 3641592-3641624,3641716-3641854 Length = 258 Score = 31.5 bits (68), Expect = 2.6 Identities = 12/38 (31%), Positives = 19/38 (50%), Gaps = 1/38 (2%) Query: 195 FWPPCCARDAWFHRRCLQ-RMALTAGMHYLKCPLCNDK 231 FW C + W+H +C++ A + KCP C+ K Sbjct: 217 FWIGCDVCERWYHGKCVKITPAKAESIKQYKCPSCSSK 254 >07_03_1219 + 24960043-24960133,24960304-24960336,24962258-24962486, 24963183-24963309,24963530-24963869,24964806-24965095 Length = 369 Score = 31.1 bits (67), Expect = 3.4 Identities = 13/40 (32%), Positives = 19/40 (47%), Gaps = 1/40 (2%) Query: 191 GVQTFWPPCCARDAWFHRRCLQ-RMALTAGMHYLKCPLCN 229 G FW C + WFH +C++ A + KCP C+ Sbjct: 220 GADEFWICCDICEKWFHGKCVKITPAKAEHIKQYKCPSCS 259 >07_01_0891 - 7447079-7447330,7447431-7447554,7449571-7449793, 7449891-7449923,7450042-7450144 Length = 244 Score = 31.1 bits (67), Expect = 3.4 Identities = 12/40 (30%), Positives = 21/40 (52%), Gaps = 1/40 (2%) Query: 195 FWPPCCARDAWFHRRCLQ-RMALTAGMHYLKCPLCNDKER 233 FW C + WFH +C++ A + + KCP C+ ++ Sbjct: 202 FWIGCDICERWFHGKCVRITPAKAEHIKHYKCPDCSSSKK 241 >08_02_0266 + 15051868-15052286,15052376-15052475,15053540-15053581, 15053734-15053930,15055412-15055508,15055604-15055699, 15056395-15056633,15056728-15056811,15056898-15057185, 15057658-15057718,15061093-15061362,15061663-15061722 Length = 650 Score = 30.7 bits (66), Expect = 4.5 Identities = 10/23 (43%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Query: 88 CSYCSRGGATLGCSVSQCRKQFH 110 C+ C +GG LGC +C++ FH Sbjct: 242 CAICDQGGILLGCK-GECKRSFH 263 >02_04_0516 + 23593088-23593116,23593209-23593336,23593527-23593714, 23593861-23593919,23594997-23595345,23596081-23596333, 23596404-23597476 Length = 692 Score = 30.7 bits (66), Expect = 4.5 Identities = 16/55 (29%), Positives = 33/55 (60%), Gaps = 1/55 (1%) Query: 664 KKKKRDHKELNKSKVYRKNERQKMKIRFKTRIKLKVCESKDKDLKQYVLSNVNNV 718 KKKK+ K+ K K +KN+++K K + K + K K + + Q+++S+ +++ Sbjct: 71 KKKKKKKKKKKKKKKKKKNKKKKKK-KKKKKKKKKKKKRWPSNKAQHIMSDTSHI 124 >02_04_0461 - 23125260-23125868 Length = 202 Score = 30.7 bits (66), Expect = 4.5 Identities = 20/73 (27%), Positives = 39/73 (53%), Gaps = 4/73 (5%) Query: 451 RKPKPLCVKRKIVDEILQGLFDTVLKESKQKEIIKKWCSPKKREIKEETEPQDIISEDTA 510 RKP PL +++ D+ L+ + + E K++ K K+RE +E+ + ++++ T Sbjct: 97 RKPTPL--EQRARDKSLKRAYQARVAELKEEIRQSKAAKRKQREEREKRKKENVLRSGTK 154 Query: 511 VAR--NPSTPVKV 521 + R NP T K+ Sbjct: 155 LQRVTNPKTIQKI 167 >02_04_0268 + 21435231-21435240,21435330-21435558,21435778-21435898, 21435992-21436264 Length = 210 Score = 30.7 bits (66), Expect = 4.5 Identities = 13/38 (34%), Positives = 19/38 (50%), Gaps = 1/38 (2%) Query: 195 FWPPCCARDAWFHRRCLQ-RMALTAGMHYLKCPLCNDK 231 FW C + WFH +C++ A + KCP C+ K Sbjct: 169 FWICCDVCEKWFHGKCVRITPAKAEHIKQYKCPGCSSK 206 >09_06_0244 + 21822811-21823246,21823337-21823468,21823949-21824037, 21824135-21824224,21825033-21825603,21826097-21826734, 21826978-21827098,21827223-21827337,21828234-21829723, 21829830-21829901,21830151-21830196,21830413-21830515, 21830591-21830674,21831035-21831475,21831651-21831746, 21831896-21832045,21832131-21832274,21832414-21832527, 21832621-21832803,21832901-21832945,21833058-21833192 Length = 1764 Score = 30.3 bits (65), Expect = 6.0 Identities = 14/44 (31%), Positives = 21/44 (47%), Gaps = 1/44 (2%) Query: 75 DILAEIERAKKHKCSYCSR-GGATLGCSVSQCRKQFHLPCGREK 117 DI + +CS C+R GG+ +GC C FH C ++ Sbjct: 1465 DISGASPAKRNTECSMCNRTGGSFMGCRDVNCSVLFHPWCAHQR 1508 >08_02_0703 - 20188489-20190246 Length = 585 Score = 30.3 bits (65), Expect = 6.0 Identities = 12/22 (54%), Positives = 12/22 (54%) Query: 299 WSGRHARCGPAPPVCASCRPAA 320 W RH R PAPP A R AA Sbjct: 111 WCARHGRAPPAPPSAAEAREAA 132 >01_01_1206 - 9702128-9702184,9702272-9702323,9702410-9702471, 9702578-9702665,9703027-9703095,9703224-9703281, 9703895-9703996,9704075-9704179,9704273-9704624, 9706005-9706100,9706427-9706501,9707192-9707370, 9707501-9707740,9707922-9708017,9708193-9708306, 9708428-9708527 Length = 614 Score = 30.3 bits (65), Expect = 6.0 Identities = 21/65 (32%), Positives = 38/65 (58%), Gaps = 4/65 (6%) Query: 436 VIIDEKILEEVREKFRKPKPLCVKRKIVDEILQGLFDTVLKESKQKEIIKKWCSPKKREI 495 V+I + +++ + F K + K K ++ILQGL D K ++QK++I+K ++R Sbjct: 144 VVIRNQEIQKAKVAFAKDEAELAKLKGEEKILQGLVD---KLTEQKKLIEK-AEEEERLR 199 Query: 496 KEETE 500 KE+ E Sbjct: 200 KEKEE 204 >01_01_0401 + 3043634-3043894,3045610-3045849 Length = 166 Score = 30.3 bits (65), Expect = 6.0 Identities = 16/42 (38%), Positives = 20/42 (47%), Gaps = 2/42 (4%) Query: 23 CAICGREVDDEVLYGKIYAIGDIQCHYFCVLLSCCLVQKGRE 64 C C V+DE + D+ HYFC C L Q+GRE Sbjct: 97 CGCCHGLVEDEGNREHLEVACDLATHYFC--HPCALCQEGRE 136 >03_06_0561 + 34728428-34728439,34728529-34728615,34728729-34728750, 34728843-34728925,34729139-34729171,34729468-34729546, 34729642-34729694,34729931-34729991,34730168-34730250, 34730418-34730513 Length = 202 Score = 29.9 bits (64), Expect = 7.9 Identities = 24/78 (30%), Positives = 40/78 (51%), Gaps = 9/78 (11%) Query: 438 IDEKILEEVREKFRKPKPLCVKRKIVDEIL-QGLFDTVLKESKQKEIIKKWCSPKKREIK 496 ++ LE+V+++F K KRK Q L + +LK+ ++ E K+ KK+E K Sbjct: 116 VERASLEQVQKRFESLK----KRKDPGSFSEQDLDERILKQQQEDEERKRQRKEKKKEKK 171 Query: 497 EE----TEPQDIISEDTA 510 +E EP++ I D A Sbjct: 172 KELAAQNEPEEDIDPDVA 189 >03_06_0465 - 34130083-34130340,34130421-34130541,34131158-34131186, 34132259-34132382,34132594-34132816,34132948-34132980, 34133106-34133208 Length = 296 Score = 29.9 bits (64), Expect = 7.9 Identities = 12/36 (33%), Positives = 19/36 (52%), Gaps = 1/36 (2%) Query: 195 FWPPCCARDAWFHRRCLQ-RMALTAGMHYLKCPLCN 229 FW C + WFH +C++ A + + KCP C+ Sbjct: 252 FWIGCDICERWFHGKCVRITPAKAEHIKHYKCPDCS 287 >01_06_1602 - 38559661-38559936,38560008-38560137,38562550-38562778, 38563627-38563659,38563746-38563896 Length = 272 Score = 29.9 bits (64), Expect = 7.9 Identities = 13/42 (30%), Positives = 20/42 (47%), Gaps = 1/42 (2%) Query: 191 GVQTFWPPCCARDAWFHRRCLQ-RMALTAGMHYLKCPLCNDK 231 G FW C + W+H +C++ A + KCP C +K Sbjct: 227 GKDEFWICCDNCEKWYHGKCVKITPARAEHIKQYKCPDCTNK 268 Database: rice Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.319 0.136 0.417 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,165,876 Number of Sequences: 37544 Number of extensions: 867033 Number of successful extensions: 2151 Number of sequences better than 10.0: 28 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 22 Number of HSP's that attempted gapping in prelim test: 2131 Number of HSP's gapped (non-prelim): 37 length of query: 760 length of database: 14,793,348 effective HSP length: 88 effective length of query: 672 effective length of database: 11,489,476 effective search space: 7720927872 effective search space used: 7720927872 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 64 (29.9 bits)
- SilkBase 1999-2023 -