BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001788-TA|BGIBMGA001788-PA|undefined (278 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value EF222294-1|ABN79654.1| 451|Tribolium castaneum ecdysis triggeri... 22 4.4 EF222293-1|ABN79653.1| 434|Tribolium castaneum ecdysis triggeri... 22 4.4 >EF222294-1|ABN79654.1| 451|Tribolium castaneum ecdysis triggering hormone receptorisoform B protein. Length = 451 Score = 22.2 bits (45), Expect = 4.4 Identities = 18/47 (38%), Positives = 22/47 (46%), Gaps = 6/47 (12%) Query: 6 MPLQQCCVTVL------PEFGVKWREVFRAVRLARLPMTAASVARVL 46 M L C TVL PE V RE+ +AV L + ASV +L Sbjct: 116 MVLLVCTPTVLVEVNSRPETWVLGREMCKAVPFVELTVAHASVLTIL 162 >EF222293-1|ABN79653.1| 434|Tribolium castaneum ecdysis triggering hormone receptorisoform A protein. Length = 434 Score = 22.2 bits (45), Expect = 4.4 Identities = 18/47 (38%), Positives = 22/47 (46%), Gaps = 6/47 (12%) Query: 6 MPLQQCCVTVL------PEFGVKWREVFRAVRLARLPMTAASVARVL 46 M L C TVL PE V RE+ +AV L + ASV +L Sbjct: 116 MVLLVCTPTVLVEVNSRPETWVLGREMCKAVPFVELTVAHASVLTIL 162 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.320 0.134 0.386 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 55,749 Number of Sequences: 317 Number of extensions: 2277 Number of successful extensions: 6 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 4 Number of HSP's gapped (non-prelim): 2 length of query: 278 length of database: 114,650 effective HSP length: 56 effective length of query: 222 effective length of database: 96,898 effective search space: 21511356 effective search space used: 21511356 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 43 (21.4 bits)
- SilkBase 1999-2023 -