BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001788-TA|BGIBMGA001788-PA|undefined (278 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value AY398690-1|AAR83734.1| 416|Apis mellifera major royal jelly pro... 28 0.080 AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. 24 1.7 >AY398690-1|AAR83734.1| 416|Apis mellifera major royal jelly protein 8 protein. Length = 416 Score = 28.3 bits (60), Expect = 0.080 Identities = 23/83 (27%), Positives = 37/83 (44%), Gaps = 1/83 (1%) Query: 125 GDLLYISVQLVSDTKEGSTL-YVATPPGESVALFSTLSMSAQIKACVDALGYRKYEDAKL 183 G L+ +SVQL+S GSTL Y+ G ++ +++ S Q +Y + Sbjct: 181 GALVTLSVQLLSCEVNGSTLVYIGDNEGFALIIYNNSDNSFQRLTSSTFASDPRYTTFTI 240 Query: 184 HGKDIPSLLRINDRAWSGMAQNL 206 +G+ I A S + QNL Sbjct: 241 NGESFTLQSGIFGMALSPLTQNL 263 >AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. Length = 898 Score = 23.8 bits (49), Expect = 1.7 Identities = 10/18 (55%), Positives = 13/18 (72%) Query: 101 EVIENNLKKGKHRFTRPE 118 +VIE+ +K KHR RPE Sbjct: 621 QVIEDAAQKKKHRAIRPE 638 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.320 0.134 0.386 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 70,486 Number of Sequences: 429 Number of extensions: 2856 Number of successful extensions: 7 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 5 Number of HSP's gapped (non-prelim): 2 length of query: 278 length of database: 140,377 effective HSP length: 57 effective length of query: 221 effective length of database: 115,924 effective search space: 25619204 effective search space used: 25619204 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 43 (21.4 bits)
- SilkBase 1999-2023 -