BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001784-TA|BGIBMGA001784-PA|IPR007087|Zinc finger, C2H2-type, IPR012934|Zinc finger, AD-type (531 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value AB207270-1|BAE72137.1| 429|Apis mellifera broad-complex protein. 31 0.031 L01587-1|AAA27734.1| 69|Apis mellifera zinc finger protein pro... 27 0.51 AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex det... 25 1.2 AY338499-1|AAR08420.1| 500|Apis mellifera Kruppel-like protein ... 25 1.6 AY569720-1|AAS86673.1| 406|Apis mellifera complementary sex det... 25 2.1 AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex det... 25 2.1 DQ325082-1|ABD14096.1| 179|Apis mellifera complementary sex det... 24 2.7 AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex det... 24 2.7 DQ325105-1|ABD14119.1| 180|Apis mellifera complementary sex det... 24 3.6 DQ325104-1|ABD14118.1| 180|Apis mellifera complementary sex det... 24 3.6 AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex det... 24 3.6 AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex det... 24 3.6 AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex det... 24 3.6 AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex det... 24 3.6 DQ325109-1|ABD14123.1| 177|Apis mellifera complementary sex det... 23 4.8 DQ325108-1|ABD14122.1| 177|Apis mellifera complementary sex det... 23 4.8 DQ325107-1|ABD14121.1| 176|Apis mellifera complementary sex det... 23 4.8 DQ325106-1|ABD14120.1| 177|Apis mellifera complementary sex det... 23 4.8 DQ325090-1|ABD14104.1| 178|Apis mellifera complementary sex det... 23 4.8 DQ325081-1|ABD14095.1| 186|Apis mellifera complementary sex det... 23 4.8 DQ325080-1|ABD14094.1| 184|Apis mellifera complementary sex det... 23 4.8 DQ325079-1|ABD14093.1| 184|Apis mellifera complementary sex det... 23 4.8 DQ325078-1|ABD14092.1| 184|Apis mellifera complementary sex det... 23 4.8 AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex det... 23 4.8 AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex det... 23 4.8 AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex det... 23 4.8 DQ325130-1|ABD14144.1| 174|Apis mellifera complementary sex det... 23 6.3 DQ325129-1|ABD14143.1| 174|Apis mellifera complementary sex det... 23 6.3 DQ325128-1|ABD14142.1| 174|Apis mellifera complementary sex det... 23 6.3 DQ325127-1|ABD14141.1| 174|Apis mellifera complementary sex det... 23 6.3 DQ325126-1|ABD14140.1| 174|Apis mellifera complementary sex det... 23 6.3 DQ325125-1|ABD14139.1| 174|Apis mellifera complementary sex det... 23 6.3 DQ325076-1|ABD14090.1| 191|Apis mellifera complementary sex det... 23 6.3 AF393496-1|AAL60421.1| 146|Apis mellifera odorant binding prote... 23 6.3 AF339140-1|AAK01304.1| 120|Apis mellifera odorant binding prote... 23 6.3 DQ325077-1|ABD14091.1| 181|Apis mellifera complementary sex det... 23 8.3 AB022908-1|BAA86909.1| 493|Apis mellifera amylase protein. 23 8.3 >AB207270-1|BAE72137.1| 429|Apis mellifera broad-complex protein. Length = 429 Score = 30.7 bits (66), Expect = 0.031 Identities = 20/71 (28%), Positives = 31/71 (43%), Gaps = 8/71 (11%) Query: 339 DIETAFKNNKIQNMSDTGGIPLNVNIEDNATLDLQFDCLKVEIDNGRSRDEAGS---GID 395 D KNN + + + G+ E+N+ L+ C +E+ G S + AG+ D Sbjct: 210 DFSMGVKNNHVSSKVEGNGVH-----EENSPLEDNIKCEPLELTGGNSGNAAGNNEDSSD 264 Query: 396 PGTAMHDHPSA 406 G A D P A Sbjct: 265 SGAAASDRPPA 275 >L01587-1|AAA27734.1| 69|Apis mellifera zinc finger protein protein. Length = 69 Score = 26.6 bits (56), Expect = 0.51 Identities = 13/40 (32%), Positives = 18/40 (45%), Gaps = 1/40 (2%) Query: 465 HGSESFQSSAYKCETCILGFQYRRPYEAHLNSRHAKVYAF 504 H F S +KCE C + +HL S H+ VY + Sbjct: 7 HLRNHFGSKPFKCEKCSYSCVNKSMLNSHLKS-HSNVYQY 45 >AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 25.4 bits (53), Expect = 1.2 Identities = 12/53 (22%), Positives = 27/53 (50%) Query: 159 KRKSKQWTRKKLKRNREKFSECFLNEVSYATSGTRNRKDLQSVLVKDEVKNEK 211 K ++ +RK+ R+RE+ + + NE Y G +++ + + ++ K K Sbjct: 250 KLLEERTSRKRYSRSREREQKSYKNEREYRKYGKTSKERSRDRMERERSKEPK 302 >AY338499-1|AAR08420.1| 500|Apis mellifera Kruppel-like protein 1 protein. Length = 500 Score = 25.0 bits (52), Expect = 1.6 Identities = 10/32 (31%), Positives = 16/32 (50%), Gaps = 1/32 (3%) Query: 469 SFQSSAYKCETCILGFQYRRPYEAHLNSRHAK 500 + + Y+C C F + Y++HL S H K Sbjct: 56 NIEEKTYQCLLCQKAFDQKNLYQSHLRS-HGK 86 >AY569720-1|AAS86673.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 24.6 bits (51), Expect = 2.1 Identities = 14/54 (25%), Positives = 27/54 (50%), Gaps = 5/54 (9%) Query: 159 KRKSKQWTRKKLKRNREKFSECFLNEVSYATSGTRNRKDLQSVLVKDEVKNEKS 212 K ++ +RK+ R+RE+ + NE SY R ++ +D ++ E+S Sbjct: 261 KLLEERTSRKRYSRSREREQRSYKNENSY-----RKYRETSKERSRDRIERERS 309 >AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 24.6 bits (51), Expect = 2.1 Identities = 17/68 (25%), Positives = 30/68 (44%), Gaps = 2/68 (2%) Query: 128 KDEVKNEVIQNFIGYVEREQEDALVNVRSVSKRKSKQWTRKKLKRNREKFSECFLNEVSY 187 ++E+KN + + I +E + +VN+ K K T RNR + + S Sbjct: 176 REEIKNVLTK--INKIEEQDTVLVVNIEKSGKESKKYATSSNSLRNRTHGFQHTSSRYSR 233 Query: 188 ATSGTRNR 195 S +R+R Sbjct: 234 ERSCSRDR 241 Score = 23.8 bits (49), Expect = 3.6 Identities = 14/54 (25%), Positives = 27/54 (50%), Gaps = 5/54 (9%) Query: 159 KRKSKQWTRKKLKRNREKFSECFLNEVSYATSGTRNRKDLQSVLVKDEVKNEKS 212 K ++ +RK+ R+RE+ + + NE SY R ++ +D + E+S Sbjct: 261 KLLEERTSRKRYSRSREREQKSYKNENSY-----RKYRETSKERSRDRTERERS 309 >DQ325082-1|ABD14096.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 24.2 bits (50), Expect = 2.7 Identities = 22/97 (22%), Positives = 43/97 (44%), Gaps = 9/97 (9%) Query: 159 KRKSKQWTRKKLKRNREKFSECFLNEVSYATSGTRNRKDLQSVLVKDEVKNEKSGSDIRM 218 K ++ +RK+ R+RE+ + + NE SY R ++ +D + E+S + Sbjct: 28 KLLEERTSRKRYSRSREREQKSYKNENSY-----RKYRETSKERSRDRTERERSREPKII 82 Query: 219 SDECVIDADFSDDSTEEIGLKDNKNCDKFSGSEGYIE 255 S + + +++ + N NC K + YIE Sbjct: 83 SS--LSNKTIHNNNNYKYNY--NNNCKKLYYNINYIE 115 >AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex determiner protein. Length = 418 Score = 24.2 bits (50), Expect = 2.7 Identities = 14/54 (25%), Positives = 28/54 (51%), Gaps = 5/54 (9%) Query: 159 KRKSKQWTRKKLKRNREKFSECFLNEVSYATSGTRNRKDLQSVLVKDEVKNEKS 212 K ++ +RK+ R+RE+ + + NE SY R ++ +D+ + E+S Sbjct: 266 KLLEERTSRKRYSRSREREQKSYKNENSY-----RKYRETSKERSRDKTERERS 314 >DQ325105-1|ABD14119.1| 180|Apis mellifera complementary sex determiner protein. Length = 180 Score = 23.8 bits (49), Expect = 3.6 Identities = 12/53 (22%), Positives = 25/53 (47%) Query: 159 KRKSKQWTRKKLKRNREKFSECFLNEVSYATSGTRNRKDLQSVLVKDEVKNEK 211 K ++ +RK+ R+RE+ + NE Y R+++ + ++ K K Sbjct: 28 KLLEERTSRKRYSRSREREQNSYKNEKEYRKYRERSKERSRDKRERERSKERK 80 >DQ325104-1|ABD14118.1| 180|Apis mellifera complementary sex determiner protein. Length = 180 Score = 23.8 bits (49), Expect = 3.6 Identities = 12/53 (22%), Positives = 25/53 (47%) Query: 159 KRKSKQWTRKKLKRNREKFSECFLNEVSYATSGTRNRKDLQSVLVKDEVKNEK 211 K ++ +RK+ R+RE+ + NE Y R+++ + ++ K K Sbjct: 28 KLLEERTSRKRYSRSREREQNSYKNEKEYRKYRERSKERSRDKRERERSKERK 80 >AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 23.8 bits (49), Expect = 3.6 Identities = 14/54 (25%), Positives = 27/54 (50%), Gaps = 5/54 (9%) Query: 159 KRKSKQWTRKKLKRNREKFSECFLNEVSYATSGTRNRKDLQSVLVKDEVKNEKS 212 K ++ +RK+ R+RE+ + + NE SY R ++ +D + E+S Sbjct: 250 KLLEERTSRKRYSRSREREQKSYKNENSY-----RKYRETSKERSRDRTERERS 298 >AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 23.8 bits (49), Expect = 3.6 Identities = 14/54 (25%), Positives = 27/54 (50%), Gaps = 5/54 (9%) Query: 159 KRKSKQWTRKKLKRNREKFSECFLNEVSYATSGTRNRKDLQSVLVKDEVKNEKS 212 K ++ +RK+ R+RE+ + + NE SY R ++ +D + E+S Sbjct: 261 KLLEERTSRKRYSRSREREQKSYKNENSY-----RKYRETSKERSRDRTERERS 309 >AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 23.8 bits (49), Expect = 3.6 Identities = 14/54 (25%), Positives = 27/54 (50%), Gaps = 5/54 (9%) Query: 159 KRKSKQWTRKKLKRNREKFSECFLNEVSYATSGTRNRKDLQSVLVKDEVKNEKS 212 K ++ +RK+ R+RE+ + + NE SY R ++ +D + E+S Sbjct: 250 KLLEERTSRKRYSRSREREQKSYKNENSY-----RKYRETSKERSRDRTERERS 298 >AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex determiner protein. Length = 413 Score = 23.8 bits (49), Expect = 3.6 Identities = 14/54 (25%), Positives = 27/54 (50%), Gaps = 5/54 (9%) Query: 159 KRKSKQWTRKKLKRNREKFSECFLNEVSYATSGTRNRKDLQSVLVKDEVKNEKS 212 K ++ +RK+ R+RE+ + + NE SY R ++ +D + E+S Sbjct: 261 KLLEERTSRKRYSRSREREQKSYKNENSY-----RKYRETSKERSRDRTERERS 309 >DQ325109-1|ABD14123.1| 177|Apis mellifera complementary sex determiner protein. Length = 177 Score = 23.4 bits (48), Expect = 4.8 Identities = 10/29 (34%), Positives = 18/29 (62%) Query: 159 KRKSKQWTRKKLKRNREKFSECFLNEVSY 187 K ++ +RK+ R+RE+ + + NE SY Sbjct: 28 KLLEERTSRKRYSRSREREKKSYKNENSY 56 >DQ325108-1|ABD14122.1| 177|Apis mellifera complementary sex determiner protein. Length = 177 Score = 23.4 bits (48), Expect = 4.8 Identities = 10/29 (34%), Positives = 18/29 (62%) Query: 159 KRKSKQWTRKKLKRNREKFSECFLNEVSY 187 K ++ +RK+ R+RE+ + + NE SY Sbjct: 28 KLLEERTSRKRYSRSREREKKSYKNENSY 56 >DQ325107-1|ABD14121.1| 176|Apis mellifera complementary sex determiner protein. Length = 176 Score = 23.4 bits (48), Expect = 4.8 Identities = 10/29 (34%), Positives = 18/29 (62%) Query: 159 KRKSKQWTRKKLKRNREKFSECFLNEVSY 187 K ++ +RK+ R+RE+ + + NE SY Sbjct: 28 KLLEERTSRKRYSRSREREKKSYKNENSY 56 >DQ325106-1|ABD14120.1| 177|Apis mellifera complementary sex determiner protein. Length = 177 Score = 23.4 bits (48), Expect = 4.8 Identities = 10/29 (34%), Positives = 18/29 (62%) Query: 159 KRKSKQWTRKKLKRNREKFSECFLNEVSY 187 K ++ +RK+ R+RE+ + + NE SY Sbjct: 28 KLLEERTSRKRYSRSREREKKSYKNENSY 56 >DQ325090-1|ABD14104.1| 178|Apis mellifera complementary sex determiner protein. Length = 178 Score = 23.4 bits (48), Expect = 4.8 Identities = 10/29 (34%), Positives = 18/29 (62%) Query: 159 KRKSKQWTRKKLKRNREKFSECFLNEVSY 187 K ++ +RK+ R+RE+ + + NE SY Sbjct: 28 KLLEERTSRKRYSRSREREQKSYKNENSY 56 >DQ325081-1|ABD14095.1| 186|Apis mellifera complementary sex determiner protein. Length = 186 Score = 23.4 bits (48), Expect = 4.8 Identities = 10/29 (34%), Positives = 18/29 (62%) Query: 159 KRKSKQWTRKKLKRNREKFSECFLNEVSY 187 K ++ +RK+ R+RE+ + + NE SY Sbjct: 28 KLLEERTSRKRYSRSREREQKSYKNENSY 56 >DQ325080-1|ABD14094.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 23.4 bits (48), Expect = 4.8 Identities = 10/29 (34%), Positives = 18/29 (62%) Query: 159 KRKSKQWTRKKLKRNREKFSECFLNEVSY 187 K ++ +RK+ R+RE+ + + NE SY Sbjct: 28 KLLEERTSRKRYSRSREREQKSYKNENSY 56 >DQ325079-1|ABD14093.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 23.4 bits (48), Expect = 4.8 Identities = 10/29 (34%), Positives = 18/29 (62%) Query: 159 KRKSKQWTRKKLKRNREKFSECFLNEVSY 187 K ++ +RK+ R+RE+ + + NE SY Sbjct: 28 KLLEERTSRKRYSRSREREQKSYKNENSY 56 >DQ325078-1|ABD14092.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 23.4 bits (48), Expect = 4.8 Identities = 10/29 (34%), Positives = 18/29 (62%) Query: 159 KRKSKQWTRKKLKRNREKFSECFLNEVSY 187 K ++ +RK+ R+RE+ + + NE SY Sbjct: 28 KLLEERTSRKRYSRSREREQKSYKNENSY 56 >AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex determiner protein. Length = 419 Score = 23.4 bits (48), Expect = 4.8 Identities = 10/29 (34%), Positives = 18/29 (62%) Query: 159 KRKSKQWTRKKLKRNREKFSECFLNEVSY 187 K ++ +RK+ R+RE+ + + NE SY Sbjct: 261 KLLEERTSRKRYSRSREREQKSYKNENSY 289 >AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex determiner protein. Length = 385 Score = 23.4 bits (48), Expect = 4.8 Identities = 10/29 (34%), Positives = 18/29 (62%) Query: 159 KRKSKQWTRKKLKRNREKFSECFLNEVSY 187 K ++ +RK+ R+RE+ + + NE SY Sbjct: 261 KLLEERTSRKRYSRSREREQKSYKNENSY 289 >AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex determiner protein. Length = 410 Score = 23.4 bits (48), Expect = 4.8 Identities = 10/29 (34%), Positives = 18/29 (62%) Query: 159 KRKSKQWTRKKLKRNREKFSECFLNEVSY 187 K ++ +RK+ R+RE+ + + NE SY Sbjct: 261 KLLEERTSRKRYSRSREREKKSYKNENSY 289 >DQ325130-1|ABD14144.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 23.0 bits (47), Expect = 6.3 Identities = 9/22 (40%), Positives = 15/22 (68%) Query: 166 TRKKLKRNREKFSECFLNEVSY 187 +RK+ R+RE+ + + NE SY Sbjct: 35 SRKRYSRSREREQKSYKNENSY 56 >DQ325129-1|ABD14143.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 23.0 bits (47), Expect = 6.3 Identities = 9/22 (40%), Positives = 15/22 (68%) Query: 166 TRKKLKRNREKFSECFLNEVSY 187 +RK+ R+RE+ + + NE SY Sbjct: 35 SRKRYSRSREREQKSYKNENSY 56 >DQ325128-1|ABD14142.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 23.0 bits (47), Expect = 6.3 Identities = 9/22 (40%), Positives = 15/22 (68%) Query: 166 TRKKLKRNREKFSECFLNEVSY 187 +RK+ R+RE+ + + NE SY Sbjct: 35 SRKRYSRSREREQKSYKNENSY 56 >DQ325127-1|ABD14141.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 23.0 bits (47), Expect = 6.3 Identities = 9/22 (40%), Positives = 15/22 (68%) Query: 166 TRKKLKRNREKFSECFLNEVSY 187 +RK+ R+RE+ + + NE SY Sbjct: 35 SRKRYSRSREREQKSYKNENSY 56 >DQ325126-1|ABD14140.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 23.0 bits (47), Expect = 6.3 Identities = 9/22 (40%), Positives = 15/22 (68%) Query: 166 TRKKLKRNREKFSECFLNEVSY 187 +RK+ R+RE+ + + NE SY Sbjct: 35 SRKRYSRSREREQKSYKNENSY 56 >DQ325125-1|ABD14139.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 23.0 bits (47), Expect = 6.3 Identities = 9/22 (40%), Positives = 15/22 (68%) Query: 166 TRKKLKRNREKFSECFLNEVSY 187 +RK+ R+RE+ + + NE SY Sbjct: 35 SRKRYSRSREREQKSYKNENSY 56 >DQ325076-1|ABD14090.1| 191|Apis mellifera complementary sex determiner protein. Length = 191 Score = 23.0 bits (47), Expect = 6.3 Identities = 14/56 (25%), Positives = 30/56 (53%), Gaps = 3/56 (5%) Query: 142 YVEREQE-DALVNVRSVSKRKSKQWTRKKLKRNREKFSECFLNEVSYATSGTRNRK 196 Y E+++ + L N + K ++ +RK+ R+RE+ + + NE Y R+++ Sbjct: 12 YKEKDRRYEKLYNEKE--KLLEERTSRKRYSRSREREQKSYKNERKYRKYRERSKE 65 >AF393496-1|AAL60421.1| 146|Apis mellifera odorant binding protein ASP6 protein. Length = 146 Score = 23.0 bits (47), Expect = 6.3 Identities = 11/41 (26%), Positives = 19/41 (46%) Query: 251 EGYIETTFEDDKFSECFLNEVSYATSSTRNRKDLQSVFVKD 291 +G F D+ C++ + AT + +N L FVK+ Sbjct: 55 DGQFRGEFPQDERLMCYMKCIMIATKAMKNDVILWDFFVKN 95 >AF339140-1|AAK01304.1| 120|Apis mellifera odorant binding protein protein. Length = 120 Score = 23.0 bits (47), Expect = 6.3 Identities = 11/41 (26%), Positives = 19/41 (46%) Query: 251 EGYIETTFEDDKFSECFLNEVSYATSSTRNRKDLQSVFVKD 291 +G F D+ C++ + AT + +N L FVK+ Sbjct: 29 DGQFRGEFPQDERLMCYMKCIMIATKAMKNDVILWDFFVKN 69 >DQ325077-1|ABD14091.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 22.6 bits (46), Expect = 8.3 Identities = 10/38 (26%), Positives = 21/38 (55%) Query: 159 KRKSKQWTRKKLKRNREKFSECFLNEVSYATSGTRNRK 196 K ++ +RK+ R+RE+ + + NE Y R+++ Sbjct: 28 KLLEERTSRKRYSRSREREQKSYKNERKYRKYRERSKE 65 >AB022908-1|BAA86909.1| 493|Apis mellifera amylase protein. Length = 493 Score = 22.6 bits (46), Expect = 8.3 Identities = 9/31 (29%), Positives = 19/31 (61%), Gaps = 2/31 (6%) Query: 445 KLYTTIELTHEQMLDERNAAHGSESFQSSAY 475 ++Y + + H M +RN AHG+ + +++ Y Sbjct: 110 RIYVDVIMNH--MSGDRNDAHGTGNSRANTY 138 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.313 0.130 0.367 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 151,423 Number of Sequences: 429 Number of extensions: 6714 Number of successful extensions: 70 Number of sequences better than 10.0: 37 Number of HSP's better than 10.0 without gapping: 35 Number of HSP's successfully gapped in prelim test: 2 Number of HSP's that attempted gapping in prelim test: 32 Number of HSP's gapped (non-prelim): 40 length of query: 531 length of database: 140,377 effective HSP length: 61 effective length of query: 470 effective length of database: 114,208 effective search space: 53677760 effective search space used: 53677760 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.9 bits) S2: 46 (22.6 bits)
- SilkBase 1999-2023 -