BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001784-TA|BGIBMGA001784-PA|IPR007087|Zinc finger, C2H2-type, IPR012934|Zinc finger, AD-type (531 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value DQ855499-1|ABH88186.1| 124|Tribolium castaneum chemosensory pro... 24 2.3 AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B prot... 22 9.2 >DQ855499-1|ABH88186.1| 124|Tribolium castaneum chemosensory protein 13 protein. Length = 124 Score = 24.2 bits (50), Expect = 2.3 Identities = 15/50 (30%), Positives = 22/50 (44%), Gaps = 1/50 (2%) Query: 169 KLKRNREKFSECFLNEVSYATSGTRNRKDLQSVLVKDEVK-NEKSGSDIR 217 K +R + + EC L SG +KD+ L + K N+K IR Sbjct: 33 KSERLMKSYFECLLGTGKCTPSGEELKKDIPDALKNECAKCNDKHKEGIR 82 >AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B protein. Length = 351 Score = 22.2 bits (45), Expect = 9.2 Identities = 10/57 (17%), Positives = 27/57 (47%) Query: 139 FIGYVEREQEDALVNVRSVSKRKSKQWTRKKLKRNREKFSECFLNEVSYATSGTRNR 195 F YV +++ L ++++R+ K W + + +N++ + + + T N+ Sbjct: 264 FNAYVSKQKRWELARNLNLTERQVKIWFQNRRMKNKKNSQRQAAQQQNNNNAATNNQ 320 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.313 0.130 0.367 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 115,223 Number of Sequences: 317 Number of extensions: 5056 Number of successful extensions: 6 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 5 Number of HSP's gapped (non-prelim): 2 length of query: 531 length of database: 114,650 effective HSP length: 60 effective length of query: 471 effective length of database: 95,630 effective search space: 45041730 effective search space used: 45041730 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.9 bits) S2: 45 (22.2 bits)
- SilkBase 1999-2023 -