BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001771-TA|BGIBMGA001771-PA|undefined (282 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value U70841-1|AAC47455.1| 377|Apis mellifera ultraviolet sensitive o... 22 7.1 AY540846-1|AAS48080.1| 541|Apis mellifera neuronal nicotinic ac... 22 7.1 AF004168-1|AAC13417.1| 377|Apis mellifera blue-sensitive opsin ... 22 7.1 AB267886-1|BAF46356.1| 567|Apis mellifera ecdysteroid receptor ... 22 7.1 DQ435327-1|ABD92642.1| 145|Apis mellifera OBP10 protein. 21 9.3 >U70841-1|AAC47455.1| 377|Apis mellifera ultraviolet sensitive opsin protein. Length = 377 Score = 21.8 bits (44), Expect = 7.1 Identities = 13/28 (46%), Positives = 16/28 (57%) Query: 81 KELRVAEKKMSEYSLKLEQCERQLAEVR 108 K LR KKM+ SL Q + + AEVR Sbjct: 252 KMLREQAKKMNVKSLVSNQDKERSAEVR 279 >AY540846-1|AAS48080.1| 541|Apis mellifera neuronal nicotinic acetylcholine receptorApisa2 subunit protein. Length = 541 Score = 21.8 bits (44), Expect = 7.1 Identities = 11/26 (42%), Positives = 12/26 (46%) Query: 38 ALQHYHSVRRKGKKQKINPAHQAKMQ 63 A H R GKK K N A A +Q Sbjct: 361 AAHKMHGRGRSGKKSKFNAAVAAAVQ 386 >AF004168-1|AAC13417.1| 377|Apis mellifera blue-sensitive opsin protein. Length = 377 Score = 21.8 bits (44), Expect = 7.1 Identities = 13/28 (46%), Positives = 16/28 (57%) Query: 81 KELRVAEKKMSEYSLKLEQCERQLAEVR 108 K LR KKM+ SL Q + + AEVR Sbjct: 252 KMLREQAKKMNVKSLVSNQDKERSAEVR 279 >AB267886-1|BAF46356.1| 567|Apis mellifera ecdysteroid receptor A isoform protein. Length = 567 Score = 21.8 bits (44), Expect = 7.1 Identities = 9/32 (28%), Positives = 18/32 (56%) Query: 146 EKQKQNDAYISELISLNYESVLPESVPAIEEL 177 ++Q+ N+ Y S + + +Y+ P S +EL Sbjct: 124 QQQQHNNGYASPMSTSSYDPYSPNSKIGRDEL 155 >DQ435327-1|ABD92642.1| 145|Apis mellifera OBP10 protein. Length = 145 Score = 21.4 bits (43), Expect = 9.3 Identities = 10/29 (34%), Positives = 17/29 (58%) Query: 253 EQAIAQMNQVAKGSNKEKASSLASDHAQL 281 ++AI++ +AKG N E A +A+L Sbjct: 109 QKAISECKGIAKGDNCEYAYRFNKCYAEL 137 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.311 0.123 0.335 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 58,062 Number of Sequences: 429 Number of extensions: 1764 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of query: 282 length of database: 140,377 effective HSP length: 57 effective length of query: 225 effective length of database: 115,924 effective search space: 26082900 effective search space used: 26082900 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.9 bits) S2: 43 (21.4 bits)
- SilkBase 1999-2023 -