BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001771-TA|BGIBMGA001771-PA|undefined (282 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AY884062-1|AAX84203.1| 712|Tribolium castaneum laccase 2B protein. 22 4.5 AY884061-1|AAX84202.1| 717|Tribolium castaneum laccase 2A protein. 22 4.5 U09586-3|AAC47272.1| 470|Tribolium castaneum integrase protein. 21 7.8 >AY884062-1|AAX84203.1| 712|Tribolium castaneum laccase 2B protein. Length = 712 Score = 22.2 bits (45), Expect = 4.5 Identities = 8/18 (44%), Positives = 11/18 (61%) Query: 43 HSVRRKGKKQKINPAHQA 60 H VR G K+K+ P Q+ Sbjct: 23 HGVRAPGAKKKVGPIDQS 40 >AY884061-1|AAX84202.1| 717|Tribolium castaneum laccase 2A protein. Length = 717 Score = 22.2 bits (45), Expect = 4.5 Identities = 8/18 (44%), Positives = 11/18 (61%) Query: 43 HSVRRKGKKQKINPAHQA 60 H VR G K+K+ P Q+ Sbjct: 23 HGVRAPGAKKKVGPIDQS 40 >U09586-3|AAC47272.1| 470|Tribolium castaneum integrase protein. Length = 470 Score = 21.4 bits (43), Expect = 7.8 Identities = 11/43 (25%), Positives = 21/43 (48%) Query: 27 TAAEHVRDARRALQHYHSVRRKGKKQKINPAHQAKMQLVTEKI 69 T E AR L+H+ ++R+K +K ++ L+ K+ Sbjct: 370 TREEIHEKARENLKHHANLRQKNQKGEVTVLEIEDWVLLKNKV 412 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.311 0.123 0.335 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 44,730 Number of Sequences: 317 Number of extensions: 1275 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of query: 282 length of database: 114,650 effective HSP length: 56 effective length of query: 226 effective length of database: 96,898 effective search space: 21898948 effective search space used: 21898948 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.9 bits) S2: 43 (21.4 bits)
- SilkBase 1999-2023 -