BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001770-TA|BGIBMGA001770-PA|undefined (1503 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value D79208-1|BAA11466.1| 567|Apis mellifera alpha-glucosidase protein. 25 6.1 AB253417-1|BAE86928.1| 567|Apis mellifera alpha-glucosidase pro... 25 6.1 >D79208-1|BAA11466.1| 567|Apis mellifera alpha-glucosidase protein. Length = 567 Score = 24.6 bits (51), Expect = 6.1 Identities = 14/52 (26%), Positives = 25/52 (48%) Query: 962 SITSEEWLVMLYMLDNFEEKMKDSFTKINPPTKPSQSNEAEIVAARGLSKII 1013 + ++EE +V L +N +K+ + N K +NE V+A G +I Sbjct: 507 NFSNEEQIVDLKAFNNVPKKLNMFYNNFNSDIKSISNNEQVKVSALGFFILI 558 >AB253417-1|BAE86928.1| 567|Apis mellifera alpha-glucosidase protein. Length = 567 Score = 24.6 bits (51), Expect = 6.1 Identities = 14/52 (26%), Positives = 25/52 (48%) Query: 962 SITSEEWLVMLYMLDNFEEKMKDSFTKINPPTKPSQSNEAEIVAARGLSKII 1013 + ++EE +V L +N +K+ + N K +NE V+A G +I Sbjct: 507 NFSNEEQIVDLKAFNNVPKKLNMFYNNFNSDIKSISNNEQVKVSALGFFILI 558 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.314 0.129 0.368 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 351,961 Number of Sequences: 429 Number of extensions: 12748 Number of successful extensions: 15 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 11 Number of HSP's gapped (non-prelim): 4 length of query: 1503 length of database: 140,377 effective HSP length: 67 effective length of query: 1436 effective length of database: 111,634 effective search space: 160306424 effective search space used: 160306424 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (22.0 bits) S2: 50 (24.2 bits)
- SilkBase 1999-2023 -