Silkworm BLAST Result against mosquito

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA001769-TA|BGIBMGA001769-PA|undefined
         (327 letters)

Database: mosquito 
           2123 sequences; 516,269 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ974164-1|ABJ52804.1|  410|Anopheles gambiae serpin 4C protein.       25   3.8  

>DQ974164-1|ABJ52804.1|  410|Anopheles gambiae serpin 4C protein.
          Length = 410

 Score = 24.6 bits (51), Expect = 3.8
 Identities = 15/42 (35%), Positives = 20/42 (47%), Gaps = 1/42 (2%)

Query: 61  IDLEYKE-GVEAPALGQYLLPLLSEQVSSANNAPERFLIRHE 101
           +DL   E G E  A    L+  +S Q++   N P   LIR E
Sbjct: 354 VDLTVNERGTEGGAATATLIDRISSQINFIVNGPFMMLIREE 395


  Database: mosquito
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 516,269
  Number of sequences in database:  2123
  
Lambda     K      H
   0.320    0.133    0.414 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 294,772
Number of Sequences: 2123
Number of extensions: 11795
Number of successful extensions: 60
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 59
Number of HSP's gapped (non-prelim): 2
length of query: 327
length of database: 516,269
effective HSP length: 64
effective length of query: 263
effective length of database: 380,397
effective search space: 100044411
effective search space used: 100044411
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.8 bits)
S2: 48 (23.4 bits)