BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001769-TA|BGIBMGA001769-PA|undefined (327 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_9220| Best HMM Match : 7tm_1 (HMM E-Value=0.24) 30 3.0 SB_25021| Best HMM Match : TP2 (HMM E-Value=2.8) 29 6.9 >SB_9220| Best HMM Match : 7tm_1 (HMM E-Value=0.24) Length = 189 Score = 29.9 bits (64), Expect = 3.0 Identities = 15/46 (32%), Positives = 24/46 (52%) Query: 187 SALVYTLIGADMSVERVSEDWVYRARFGCHCRLCLCTANNSAALAV 232 S L L A++ ++ V+ W+ RA G L + T NN A++V Sbjct: 87 SVLAIPLNNAELWIDFVTNHWICRALRGAQIALPIITMNNLIAISV 132 >SB_25021| Best HMM Match : TP2 (HMM E-Value=2.8) Length = 643 Score = 28.7 bits (61), Expect = 6.9 Identities = 14/42 (33%), Positives = 25/42 (59%) Query: 82 LSEQVSSANNAPERFLIRHEDILQLLASAEENARDSNPLADE 123 L + S A+N+ E + HE++ + +A+EN +D N AD+ Sbjct: 152 LEKDASVADNSSEDKMEAHENMQGVNDAADENMQDVNDAADD 193 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.320 0.133 0.414 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,460,897 Number of Sequences: 59808 Number of extensions: 379540 Number of successful extensions: 839 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 837 Number of HSP's gapped (non-prelim): 2 length of query: 327 length of database: 16,821,457 effective HSP length: 82 effective length of query: 245 effective length of database: 11,917,201 effective search space: 2919714245 effective search space used: 2919714245 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 60 (28.3 bits)
- SilkBase 1999-2023 -