BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001769-TA|BGIBMGA001769-PA|undefined (327 letters) Database: human 224,733 sequences; 73,234,838 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC113685-1|AAI13686.1| 450|Homo sapiens chromosome 9 open readi... 32 2.4 BC113683-1|AAI13684.1| 450|Homo sapiens chromosome 9 open readi... 32 2.4 AL355140-3|CAI15446.1| 285|Homo sapiens chromosome 9 open readi... 32 2.4 AL355140-2|CAI15445.2| 450|Homo sapiens chromosome 9 open readi... 32 2.4 AK126127-1|BAC86453.1| 450|Homo sapiens BP3). protein. 32 2.4 AK056152-1|BAB71105.1| 289|Homo sapiens protein ( Homo sapiens ... 32 2.4 >BC113685-1|AAI13686.1| 450|Homo sapiens chromosome 9 open reading frame 61 protein. Length = 450 Score = 32.3 bits (70), Expect = 2.4 Identities = 21/59 (35%), Positives = 28/59 (47%), Gaps = 1/59 (1%) Query: 110 AEENARDSNPLADEV-PLQPHHALSHMDSFEFEEPPVSPDEEAALLHYICEAETDVAVR 167 AEENA S P + V P++ AL + + +P + P EE A CEA T R Sbjct: 243 AEENASTSTPSSTLVRPIRSRRALPPLRTRSKSDPVLHPSEERAAPVLSCEAATQTERR 301 >BC113683-1|AAI13684.1| 450|Homo sapiens chromosome 9 open reading frame 61 protein. Length = 450 Score = 32.3 bits (70), Expect = 2.4 Identities = 21/59 (35%), Positives = 28/59 (47%), Gaps = 1/59 (1%) Query: 110 AEENARDSNPLADEV-PLQPHHALSHMDSFEFEEPPVSPDEEAALLHYICEAETDVAVR 167 AEENA S P + V P++ AL + + +P + P EE A CEA T R Sbjct: 243 AEENASTSTPSSTLVRPIRSRRALPPLRTRSKSDPVLHPSEERAAPVLSCEAATQTERR 301 >AL355140-3|CAI15446.1| 285|Homo sapiens chromosome 9 open reading frame 61 protein. Length = 285 Score = 32.3 bits (70), Expect = 2.4 Identities = 21/59 (35%), Positives = 28/59 (47%), Gaps = 1/59 (1%) Query: 110 AEENARDSNPLADEV-PLQPHHALSHMDSFEFEEPPVSPDEEAALLHYICEAETDVAVR 167 AEENA S P + V P++ AL + + +P + P EE A CEA T R Sbjct: 78 AEENASTSTPSSTLVRPIRSRRALPPLRTRSKSDPVLHPSEERAAPVLSCEAATQTERR 136 >AL355140-2|CAI15445.2| 450|Homo sapiens chromosome 9 open reading frame 61 protein. Length = 450 Score = 32.3 bits (70), Expect = 2.4 Identities = 21/59 (35%), Positives = 28/59 (47%), Gaps = 1/59 (1%) Query: 110 AEENARDSNPLADEV-PLQPHHALSHMDSFEFEEPPVSPDEEAALLHYICEAETDVAVR 167 AEENA S P + V P++ AL + + +P + P EE A CEA T R Sbjct: 243 AEENASTSTPSSTLVRPIRSRRALPPLRTRSKSDPVLHPSEERAAPVLSCEAATQTERR 301 >AK126127-1|BAC86453.1| 450|Homo sapiens BP3). protein. Length = 450 Score = 32.3 bits (70), Expect = 2.4 Identities = 21/59 (35%), Positives = 28/59 (47%), Gaps = 1/59 (1%) Query: 110 AEENARDSNPLADEV-PLQPHHALSHMDSFEFEEPPVSPDEEAALLHYICEAETDVAVR 167 AEENA S P + V P++ AL + + +P + P EE A CEA T R Sbjct: 243 AEENASTSTPSSTLVRPIRSRRALPPLRTRSKSDPVLHPSEERAAPVLSCEAATQTERR 301 >AK056152-1|BAB71105.1| 289|Homo sapiens protein ( Homo sapiens cDNA FLJ31590 fis, clone NT2RI2002270, highly similar to X123 protein. ). Length = 289 Score = 32.3 bits (70), Expect = 2.4 Identities = 21/59 (35%), Positives = 28/59 (47%), Gaps = 1/59 (1%) Query: 110 AEENARDSNPLADEV-PLQPHHALSHMDSFEFEEPPVSPDEEAALLHYICEAETDVAVR 167 AEENA S P + V P++ AL + + +P + P EE A CEA T R Sbjct: 82 AEENASTSTPSSTLVRPIRSRRALPPLRTRSKSDPVLHPSEERAAPVLSCEAATQTERR 140 Database: human Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 73,234,838 Number of sequences in database: 224,733 Lambda K H 0.320 0.133 0.414 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 42,554,550 Number of Sequences: 224733 Number of extensions: 1689893 Number of successful extensions: 3416 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 6 Number of HSP's that attempted gapping in prelim test: 3416 Number of HSP's gapped (non-prelim): 6 length of query: 327 length of database: 73,234,838 effective HSP length: 90 effective length of query: 237 effective length of database: 53,008,868 effective search space: 12563101716 effective search space used: 12563101716 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 65 (30.3 bits)
- SilkBase 1999-2023 -