BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001767-TA|BGIBMGA001767-PA|IPR002048|Calcium-binding EF-hand (143 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value U04271-2|AAA03709.1| 490|Tribolium castaneum alpha-amylase II p... 22 1.9 DQ414247-1|ABD63009.2| 414|Tribolium castaneum paired protein. 21 5.7 X06905-1|CAA30009.1| 489|Tribolium castaneum protein ( Triboliu... 20 7.5 U04271-1|AAA03708.1| 490|Tribolium castaneum alpha-amylase I pr... 20 7.5 AM292362-1|CAL23174.2| 398|Tribolium castaneum gustatory recept... 20 7.5 >U04271-2|AAA03709.1| 490|Tribolium castaneum alpha-amylase II protein. Length = 490 Score = 22.2 bits (45), Expect = 1.9 Identities = 10/41 (24%), Positives = 21/41 (51%) Query: 11 FYLFARSGQITSLDELTVIMRSLGMSPTIQELAGYLKGKGG 51 + L RSG T+L ++ ++G+ + + ++ G GG Sbjct: 84 YILNTRSGDETALADMISRCNAVGVRIYVDTVINHMTGMGG 124 >DQ414247-1|ABD63009.2| 414|Tribolium castaneum paired protein. Length = 414 Score = 20.6 bits (41), Expect = 5.7 Identities = 6/17 (35%), Positives = 13/17 (76%) Query: 36 SPTIQELAGYLKGKGGK 52 +P++ ++ L+GKGG+ Sbjct: 151 APSVSAISRLLRGKGGE 167 >X06905-1|CAA30009.1| 489|Tribolium castaneum protein ( Tribolium castaneum mRNAfor alhpa amylase 3'region. ). Length = 489 Score = 20.2 bits (40), Expect = 7.5 Identities = 9/41 (21%), Positives = 20/41 (48%) Query: 11 FYLFARSGQITSLDELTVIMRSLGMSPTIQELAGYLKGKGG 51 + L RSG +L ++ ++G+ + + ++ G GG Sbjct: 83 YILNTRSGDEAALADMISRCNAVGVRIYVDTVINHMTGMGG 123 >U04271-1|AAA03708.1| 490|Tribolium castaneum alpha-amylase I protein. Length = 490 Score = 20.2 bits (40), Expect = 7.5 Identities = 9/41 (21%), Positives = 20/41 (48%) Query: 11 FYLFARSGQITSLDELTVIMRSLGMSPTIQELAGYLKGKGG 51 + L RSG +L ++ ++G+ + + ++ G GG Sbjct: 84 YILNTRSGDEAALADMISRCNAVGVRIYVDTVINHMTGMGG 124 >AM292362-1|CAL23174.2| 398|Tribolium castaneum gustatory receptor candidate 41 protein. Length = 398 Score = 20.2 bits (40), Expect = 7.5 Identities = 8/11 (72%), Positives = 8/11 (72%) Query: 3 LISEFRECFYL 13 LI EF ECF L Sbjct: 222 LIDEFNECFGL 232 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.320 0.135 0.387 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 29,314 Number of Sequences: 317 Number of extensions: 1071 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of query: 143 length of database: 114,650 effective HSP length: 51 effective length of query: 92 effective length of database: 98,483 effective search space: 9060436 effective search space used: 9060436 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.9 bits) S2: 39 (19.8 bits)
- SilkBase 1999-2023 -