BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001762-TA|BGIBMGA001762-PA|IPR013053|Hormone binding (167 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AY920544-1|AAX62142.1| 463|Tribolium castaneum cytochrome P450 ... 24 0.76 AM292380-1|CAL23192.2| 489|Tribolium castaneum gustatory recept... 22 3.1 AM292346-1|CAL23158.2| 314|Tribolium castaneum gustatory recept... 22 3.1 DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 prot... 21 7.1 AM292359-1|CAL23171.2| 436|Tribolium castaneum gustatory recept... 20 9.3 >AY920544-1|AAX62142.1| 463|Tribolium castaneum cytochrome P450 monooxygenase protein. Length = 463 Score = 23.8 bits (49), Expect = 0.76 Identities = 12/26 (46%), Positives = 16/26 (61%), Gaps = 1/26 (3%) Query: 125 FLGNLVPELLEVFETEI-NEIVTDIF 149 FL +LVP++ E FE + VTD F Sbjct: 177 FLAHLVPKIAEFFEYRVLPRKVTDFF 202 >AM292380-1|CAL23192.2| 489|Tribolium castaneum gustatory receptor candidate 59 protein. Length = 489 Score = 21.8 bits (44), Expect = 3.1 Identities = 9/20 (45%), Positives = 14/20 (70%) Query: 108 EITGIFNDPVLSEFVSRFLG 127 EI IF+ P+L + S+F+G Sbjct: 233 EIQTIFSVPLLMKIASQFVG 252 >AM292346-1|CAL23158.2| 314|Tribolium castaneum gustatory receptor candidate 25 protein. Length = 314 Score = 21.8 bits (44), Expect = 3.1 Identities = 9/20 (45%), Positives = 14/20 (70%) Query: 108 EITGIFNDPVLSEFVSRFLG 127 EI IF+ P+L + S+F+G Sbjct: 58 EIQTIFSVPLLMKIASQFVG 77 >DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 protein. Length = 980 Score = 20.6 bits (41), Expect = 7.1 Identities = 12/29 (41%), Positives = 14/29 (48%) Query: 28 RGLFGLSIDGEVPVIALDAGKYDLSVTAL 56 RG GL ID E P + D Y L + L Sbjct: 201 RGFDGLDIDWEYPKGSEDKKNYVLLLKEL 229 >AM292359-1|CAL23171.2| 436|Tribolium castaneum gustatory receptor candidate 38 protein. Length = 436 Score = 20.2 bits (40), Expect = 9.3 Identities = 9/39 (23%), Positives = 19/39 (48%) Query: 23 IISVLRGLFGLSIDGEVPVIALDAGKYDLSVTALGFTIY 61 + V+ G G +V ++ G+++ +V FT+Y Sbjct: 100 VFVVVMGYIGFIEWDKVEIVRSQEGRFEEAVIDYLFTVY 138 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.323 0.145 0.395 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 31,720 Number of Sequences: 317 Number of extensions: 1225 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of query: 167 length of database: 114,650 effective HSP length: 52 effective length of query: 115 effective length of database: 98,166 effective search space: 11289090 effective search space used: 11289090 T: 11 A: 40 X1: 16 ( 7.5 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.4 bits) S2: 40 (20.2 bits)
- SilkBase 1999-2023 -