BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001762-TA|BGIBMGA001762-PA|IPR013053|Hormone binding (167 letters) Database: human 224,733 sequences; 73,234,838 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC027859-1|AAH27859.2| 415|Homo sapiens SERPINI2 protein protein. 29 6.0 AF130470-1|AAD34723.1| 405|Homo sapiens serpin-like protein pro... 29 6.0 AB006423-1|BAA33766.1| 405|Homo sapiens TSA2004 protein. 29 6.0 >BC027859-1|AAH27859.2| 415|Homo sapiens SERPINI2 protein protein. Length = 415 Score = 29.5 bits (63), Expect = 6.0 Identities = 19/65 (29%), Positives = 34/65 (52%), Gaps = 2/65 (3%) Query: 93 LQEADVAISLEGFQTEITGIFNDPVLSEFVSR-FLGNL-VPELLEVFETEINEIVTDIFF 150 +QE +V ISL F+ E F D + S ++ F G + + + E ++++ +FF Sbjct: 288 MQEEEVEISLPRFKVEQKVDFKDVLYSLNITEIFSGGCDLSGITDSSEVYVSQVTQKVFF 347 Query: 151 EIAQD 155 EI +D Sbjct: 348 EINED 352 >AF130470-1|AAD34723.1| 405|Homo sapiens serpin-like protein protein. Length = 405 Score = 29.5 bits (63), Expect = 6.0 Identities = 19/65 (29%), Positives = 34/65 (52%), Gaps = 2/65 (3%) Query: 93 LQEADVAISLEGFQTEITGIFNDPVLSEFVSR-FLGNL-VPELLEVFETEINEIVTDIFF 150 +QE +V ISL F+ E F D + S ++ F G + + + E ++++ +FF Sbjct: 278 MQEEEVEISLPRFKVEQKVDFKDVLYSLNITEIFSGGCDLSGITDSSEVYVSQVTQKVFF 337 Query: 151 EIAQD 155 EI +D Sbjct: 338 EINED 342 >AB006423-1|BAA33766.1| 405|Homo sapiens TSA2004 protein. Length = 405 Score = 29.5 bits (63), Expect = 6.0 Identities = 19/65 (29%), Positives = 34/65 (52%), Gaps = 2/65 (3%) Query: 93 LQEADVAISLEGFQTEITGIFNDPVLSEFVSR-FLGNL-VPELLEVFETEINEIVTDIFF 150 +QE +V ISL F+ E F D + S ++ F G + + + E ++++ +FF Sbjct: 278 MQEEEVEISLPRFKVEQKVDFKDVLYSLNITEIFSGGCDLSGITDSSEVYVSQVTQKVFF 337 Query: 151 EIAQD 155 EI +D Sbjct: 338 EINED 342 Database: human Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 73,234,838 Number of sequences in database: 224,733 Lambda K H 0.323 0.145 0.395 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,232,852 Number of Sequences: 224733 Number of extensions: 667364 Number of successful extensions: 1228 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 3 Number of HSP's that attempted gapping in prelim test: 1228 Number of HSP's gapped (non-prelim): 3 length of query: 167 length of database: 73,234,838 effective HSP length: 85 effective length of query: 82 effective length of database: 54,132,533 effective search space: 4438867706 effective search space used: 4438867706 T: 11 A: 40 X1: 16 ( 7.5 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.9 bits) S2: 62 (29.1 bits)
- SilkBase 1999-2023 -