BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001762-TA|BGIBMGA001762-PA|IPR013053|Hormone binding (167 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value AJ780964-1|CAG62942.2| 332|Apis mellifera putative corticotropi... 23 1.2 AF069739-1|AAC63272.2| 690|Apis mellifera translation initiatio... 22 3.6 >AJ780964-1|CAG62942.2| 332|Apis mellifera putative corticotropin releasing hormone-binding protein protein. Length = 332 Score = 23.4 bits (48), Expect = 1.2 Identities = 13/23 (56%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Query: 15 EINSLTFDIISVLRGLFGLSIDG 37 EIN +TFDI RGL + IDG Sbjct: 105 EINFITFDIPCEHRGLVSI-IDG 126 >AF069739-1|AAC63272.2| 690|Apis mellifera translation initiation factor 2 protein. Length = 690 Score = 21.8 bits (44), Expect = 3.6 Identities = 13/48 (27%), Positives = 23/48 (47%) Query: 104 GFQTEITGIFNDPVLSEFVSRFLGNLVPELLEVFETEINEIVTDIFFE 151 GF T D + VS N+V +L++ + EI +I+ ++ E Sbjct: 536 GFNVNATKQIKDEANKKGVSLRFYNVVYKLIDNIKKEIYDILPEVDVE 583 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.323 0.145 0.395 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 36,033 Number of Sequences: 429 Number of extensions: 1298 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of query: 167 length of database: 140,377 effective HSP length: 53 effective length of query: 114 effective length of database: 117,640 effective search space: 13410960 effective search space used: 13410960 T: 11 A: 40 X1: 16 ( 7.5 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.9 bits) S2: 41 (20.6 bits)
- SilkBase 1999-2023 -