BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001760-TA|BGIBMGA001760-PA|undefined (112 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q8NTX5 Cluster: Transcriptional regulators; n=1; Coryne... 33 1.5 UniRef50_A4VDP2 Cluster: Cyclic nucleotide phosphodiesterase; n=... 32 2.0 UniRef50_Q23R36 Cluster: Putative uncharacterized protein; n=1; ... 31 4.6 >UniRef50_Q8NTX5 Cluster: Transcriptional regulators; n=1; Corynebacterium glutamicum|Rep: Transcriptional regulators - Corynebacterium glutamicum (Brevibacterium flavum) Length = 102 Score = 32.7 bits (71), Expect = 1.5 Identities = 18/51 (35%), Positives = 28/51 (54%), Gaps = 2/51 (3%) Query: 2 LEIYRIYSNVTLHMAVNFTIYDSLNAYHVLQSDYNEIKVEQNLFYEVLAKH 52 LE RI N T+H V + +LN+ V +DY ++ E + Y +L+KH Sbjct: 3 LEEARIALNDTIHSPVRLALMAALNS--VDSADYQSLREELGVSYSLLSKH 51 >UniRef50_A4VDP2 Cluster: Cyclic nucleotide phosphodiesterase; n=1; Tetrahymena thermophila SB210|Rep: Cyclic nucleotide phosphodiesterase - Tetrahymena thermophila SB210 Length = 1074 Score = 32.3 bits (70), Expect = 2.0 Identities = 12/32 (37%), Positives = 23/32 (71%) Query: 20 TIYDSLNAYHVLQSDYNEIKVEQNLFYEVLAK 51 TIY+ +Y++ + DY+ VE+NL Y+++A+ Sbjct: 514 TIYNFEKSYYIHKGDYSSEDVEENLQYQIIAQ 545 >UniRef50_Q23R36 Cluster: Putative uncharacterized protein; n=1; Tetrahymena thermophila SB210|Rep: Putative uncharacterized protein - Tetrahymena thermophila SB210 Length = 1240 Score = 31.1 bits (67), Expect = 4.6 Identities = 19/48 (39%), Positives = 24/48 (50%), Gaps = 1/48 (2%) Query: 7 IYSNVTLHMAVNFTIYDSLNAYHVLQSDYNEIKVEQNLFYEVLAKHEG 54 I SN+ N +Y+ LN H S Y E+ V+QNL VL EG Sbjct: 1028 IQSNMLPDYLRNIEVYEKLNYIHCDSSRYAEL-VKQNLQENVLKNEEG 1074 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.321 0.137 0.422 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 93,346,327 Number of Sequences: 1657284 Number of extensions: 2204119 Number of successful extensions: 5425 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 2 Number of HSP's that attempted gapping in prelim test: 5424 Number of HSP's gapped (non-prelim): 3 length of query: 112 length of database: 575,637,011 effective HSP length: 88 effective length of query: 24 effective length of database: 429,796,019 effective search space: 10315104456 effective search space used: 10315104456 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.9 bits) S2: 65 (30.3 bits)
- SilkBase 1999-2023 -