BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001760-TA|BGIBMGA001760-PA|undefined (112 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_04_1332 + 32718584-32718706,32718892-32718960,32719069-327191... 27 2.6 >04_04_1332 + 32718584-32718706,32718892-32718960,32719069-32719155, 32719865-32719971,32720066-32720187,32720462-32720535, 32720833-32720946,32721100-32721213 Length = 269 Score = 27.5 bits (58), Expect = 2.6 Identities = 15/44 (34%), Positives = 25/44 (56%), Gaps = 4/44 (9%) Query: 11 VTLHMAVNF---TIYDSLNAYHVLQSDYNEIKVEQNLFYEVLAK 51 V +H VNF T YD + Y +LQ +N++++ +N+ L K Sbjct: 60 VPMHK-VNFDAKTEYDMIQNYKILQDVFNKLRLSKNIEVNKLVK 102 Database: rice Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.321 0.137 0.422 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,390,981 Number of Sequences: 37544 Number of extensions: 51780 Number of successful extensions: 68 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 67 Number of HSP's gapped (non-prelim): 1 length of query: 112 length of database: 14,793,348 effective HSP length: 73 effective length of query: 39 effective length of database: 12,052,636 effective search space: 470052804 effective search space used: 470052804 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.9 bits) S2: 54 (25.8 bits)
- SilkBase 1999-2023 -