BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001760-TA|BGIBMGA001760-PA|undefined (112 letters) Database: fruitfly 52,641 sequences; 24,830,863 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY051668-1|AAK93092.1| 507|Drosophila melanogaster LD21785p pro... 26 9.7 AE014296-2430|AAF49704.1| 507|Drosophila melanogaster CG5295-PA... 26 9.7 >AY051668-1|AAK93092.1| 507|Drosophila melanogaster LD21785p protein. Length = 507 Score = 26.2 bits (55), Expect = 9.7 Identities = 11/40 (27%), Positives = 23/40 (57%) Query: 14 HMAVNFTIYDSLNAYHVLQSDYNEIKVEQNLFYEVLAKHE 53 H+ T D+L AY+ S+ N++KV + ++ + +H+ Sbjct: 417 HVLKMTTHNDALYAYYYTDSNTNKVKVTEIFDFDEITEHD 456 >AE014296-2430|AAF49704.1| 507|Drosophila melanogaster CG5295-PA protein. Length = 507 Score = 26.2 bits (55), Expect = 9.7 Identities = 11/40 (27%), Positives = 23/40 (57%) Query: 14 HMAVNFTIYDSLNAYHVLQSDYNEIKVEQNLFYEVLAKHE 53 H+ T D+L AY+ S+ N++KV + ++ + +H+ Sbjct: 417 HVLKMTTHNDALYAYYYTDSNTNKVKVTEIFDFDEITEHD 456 Database: fruitfly Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 24,830,863 Number of sequences in database: 52,641 Lambda K H 0.321 0.137 0.422 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,954,100 Number of Sequences: 52641 Number of extensions: 89760 Number of successful extensions: 236 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 234 Number of HSP's gapped (non-prelim): 2 length of query: 112 length of database: 24,830,863 effective HSP length: 75 effective length of query: 37 effective length of database: 20,882,788 effective search space: 772663156 effective search space used: 772663156 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.9 bits) S2: 55 (26.2 bits)
- SilkBase 1999-2023 -