BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001760-TA|BGIBMGA001760-PA|undefined (112 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value DQ325089-1|ABD14103.1| 185|Apis mellifera complementary sex det... 22 1.5 DQ325088-1|ABD14102.1| 185|Apis mellifera complementary sex det... 22 1.5 AY242387-1|AAO72539.2| 693|Apis mellifera prophenoloxidase prot... 21 3.5 AY769960-1|AAV34676.1| 603|Apis mellifera soluble guanylyl cycl... 21 4.6 AB181489-1|BAD22772.1| 603|Apis mellifera soluble guanylyl cycl... 21 4.6 >DQ325089-1|ABD14103.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 22.2 bits (45), Expect = 1.5 Identities = 8/32 (25%), Positives = 18/32 (56%) Query: 18 NFTIYDSLNAYHVLQSDYNEIKVEQNLFYEVL 49 N TI+++ Y+ ++YN + L+Y ++ Sbjct: 86 NNTIHNNNYKYNYNNNNYNNNNYNKKLYYNII 117 >DQ325088-1|ABD14102.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 22.2 bits (45), Expect = 1.5 Identities = 8/32 (25%), Positives = 18/32 (56%) Query: 18 NFTIYDSLNAYHVLQSDYNEIKVEQNLFYEVL 49 N TI+++ Y+ ++YN + L+Y ++ Sbjct: 86 NNTIHNNNYKYNYNNNNYNNNNYNKKLYYNII 117 >AY242387-1|AAO72539.2| 693|Apis mellifera prophenoloxidase protein. Length = 693 Score = 21.0 bits (42), Expect = 3.5 Identities = 8/14 (57%), Positives = 11/14 (78%) Query: 30 VLQSDYNEIKVEQN 43 V+ SDY + +VEQN Sbjct: 603 VMVSDYKDDRVEQN 616 >AY769960-1|AAV34676.1| 603|Apis mellifera soluble guanylyl cyclase beta 1 subunit protein. Length = 603 Score = 20.6 bits (41), Expect = 4.6 Identities = 7/31 (22%), Positives = 15/31 (48%) Query: 21 IYDSLNAYHVLQSDYNEIKVEQNLFYEVLAK 51 IYD Y+++ + N + + N E+ + Sbjct: 42 IYDDEITYNIISAAVNRLNIPANEILELFGR 72 >AB181489-1|BAD22772.1| 603|Apis mellifera soluble guanylyl cyclase beta 1 subunit protein. Length = 603 Score = 20.6 bits (41), Expect = 4.6 Identities = 7/31 (22%), Positives = 15/31 (48%) Query: 21 IYDSLNAYHVLQSDYNEIKVEQNLFYEVLAK 51 IYD Y+++ + N + + N E+ + Sbjct: 42 IYDDEITYNIISAAVNRLNIPANEILELFGR 72 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.321 0.137 0.422 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,733 Number of Sequences: 429 Number of extensions: 631 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of query: 112 length of database: 140,377 effective HSP length: 50 effective length of query: 62 effective length of database: 118,927 effective search space: 7373474 effective search space used: 7373474 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.9 bits) S2: 39 (19.8 bits)
- SilkBase 1999-2023 -