BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001758-TA|BGIBMGA001758-PA|undefined (171 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value DQ494421-1|ABF55372.1| 73|Tribolium castaneum telomerase rever... 23 1.8 DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase rever... 23 1.8 DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulati... 22 2.4 >DQ494421-1|ABF55372.1| 73|Tribolium castaneum telomerase reverse transcriptase protein. Length = 73 Score = 22.6 bits (46), Expect = 1.8 Identities = 11/32 (34%), Positives = 18/32 (56%) Query: 122 INESKYEGVLNLSVKDGRRGHGRKQTAPRRIV 153 I SKY +LN+++K+ R K P +I+ Sbjct: 18 IVNSKYNSILNIALKNFRLCKKHKTKKPVQIL 49 >DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase reverse transcriptase protein. Length = 596 Score = 22.6 bits (46), Expect = 1.8 Identities = 11/32 (34%), Positives = 18/32 (56%) Query: 122 INESKYEGVLNLSVKDGRRGHGRKQTAPRRIV 153 I SKY +LN+++K+ R K P +I+ Sbjct: 18 IVNSKYNSILNIALKNFRLCKKHKTKKPVQIL 49 >DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulation protein. Length = 947 Score = 22.2 bits (45), Expect = 2.4 Identities = 8/19 (42%), Positives = 12/19 (63%) Query: 145 KQTAPRRIVYCDSEDNVLD 163 K PR + + DSE N+L+ Sbjct: 188 KAARPRSLQFVDSEGNILE 206 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.316 0.133 0.380 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 31,324 Number of Sequences: 317 Number of extensions: 1081 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of query: 171 length of database: 114,650 effective HSP length: 53 effective length of query: 118 effective length of database: 97,849 effective search space: 11546182 effective search space used: 11546182 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.1 bits) S2: 40 (20.2 bits)
- SilkBase 1999-2023 -