Silkworm BLAST Result against nematostella

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA001758-TA|BGIBMGA001758-PA|undefined
         (171 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_21276| Best HMM Match : No HMM Matches (HMM E-Value=.)              30   0.89 

>SB_21276| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 364

 Score = 30.3 bits (65), Expect = 0.89
 Identities = 20/65 (30%), Positives = 29/65 (44%), Gaps = 2/65 (3%)

Query: 107 FRCDDVKKICAQTFYINESKYEGVLNLSVKDGRRGHGRKQTAPRRIVYCDSEDNVLDLKI 166
           F C     IC  T     + + G  N++ +D   G GR Q A +R+V  +  D   DL  
Sbjct: 4   FSCTYFCHICNSTCLNKFNLFTGSKNVTARDKSGGSGRTQEANKRVV--NFLDVTFDLNR 61

Query: 167 KTEKP 171
            T +P
Sbjct: 62  NTYQP 66


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.316    0.133    0.380 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 4,856,842
Number of Sequences: 59808
Number of extensions: 159351
Number of successful extensions: 363
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 362
Number of HSP's gapped (non-prelim): 1
length of query: 171
length of database: 16,821,457
effective HSP length: 77
effective length of query: 94
effective length of database: 12,216,241
effective search space: 1148326654
effective search space used: 1148326654
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.6 bits)
S2: 57 (27.1 bits)